Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q5TBE3 Q5TBE4
Symbols bA507D14.1

Gene

 Compartment GO Term (1)

AA Sequence

MFLTGDTSPAEDNREATLPQCSLPELYACIENFNKESKKSNLLKMHGISLNEAQEVLARNLNVMSFTRGA      1 - 70
DVRGDLQPVISVNKMNKPGKHRKTPSPKINK                                            71 - 101
//

Text Mined References (3)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.