Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MFLTGDTSPAEDNREATLPQCSLPELYACIENFNKESKKSNLLKMHGISLNEAQEVLARNLNVMSFTRGA      1 - 70
DVRGDLQPVISVNKMNKPGKHRKTPSPKINK                                            71 - 101
//

Text Mined References (3)

PMID Year Title