Property Summary

NCBI Gene PubMed Count 9
PubMed Score 11.43
PubTator Score 4.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
non-small cell lung carcinoma 413 7.40562133613388E-13
lung adenocarcinoma 2714 1.28905151668264E-12
osteosarcoma 7933 2.10123682927872E-8
pancreatic cancer 2300 0.00107691105536639
intraductal papillary-mucinous adenoma (IPMA) 2956 0.001762817050901
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00182534140748878
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0485749913983443
Disease Target Count Z-score Confidence
Rheumatoid Arthritis 1171 0.0 2.0
Disease Target Count Z-score Confidence
Contagious pustular dermatitis 12 4.217 2.1

Expression

Gene RIF (1)

PMID Text
15961081 In the transition from normal tissue to tumour, pro-apoptotic Bfk isoform expression is substantially reduced in up to 80% of tumours isolated from the human gastrointestinal tract compared to tumours from outside the gastrointestinal tract.

AA Sequence

MKSSQTFEEQTECIVNTLLMDFLSPTLQVASRNLCCVDEVDSGEPCSFDVAIIAGRLRMLGDQFNGELEA      1 - 70
SAKNVIAETIKGQTGAILQDTVESLSKTWCAQDSSLAYERAFLAVSVKLLEYMAHIAPEVVGQVAIPMTG     71 - 140
MINGNQAIREFIQGQGGWENLES                                                   141 - 163
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
17412810 2007 Bfk, a novel member of the bcl2 gene family, is highly expressed in principal cells of the mouse epididymis and demonstrates a predominant nuclear localization.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16690252 2006 Differential expression of apoptosis-related proteins in various cellular components of ameloblastomas.
15961081 2005 Expression of pro-apoptotic Bfk isoforms reduces during malignant transformation in the human gastrointestinal tract.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12700646 2003 Bfk: a novel weakly proapoptotic member of the Bcl-2 protein family with a BH3 and a BH2 region.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.