Property Summary

NCBI Gene PubMed Count 23
PubMed Score 27.15
PubTator Score 7.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Aicardi-Goutieres syndrome 19 6.856 3.4
Disease Target Count
AICARDI-GOUTIERES SYNDROME 1 5
Disease Target Count P-value
malignant mesothelioma 3232 4.9e-08
osteosarcoma 7950 5.0e-07
tuberculosis 2010 3.5e-05
astrocytic glioma 2597 4.5e-02
group 3 medulloblastoma 4104 4.8e-02
Disease Target Count
Aicardi-Goutieres Syndrome 2 1

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.600 4.5e-02
group 3 medulloblastoma 1.100 4.8e-02
malignant mesothelioma 2.100 4.9e-08
osteosarcoma -2.168 5.0e-07
tuberculosis 1.100 3.5e-05

Pathway (1)

Gene RIF (8)

AA Sequence

MAAGVDCGDGVGARQHVFLVSEYLKDASKKMKNGLMFVKLVNPCSGEGAIYLFNMCLQQLFEVKVFKEKH      1 - 70
HSWFINQSVQSGGLLHFATPVDPLFLLLHYLIKADKEGKFQPLDQVVVDNVFPNCILLLKLPGLEKLLHH     71 - 140
VTEEKGNPEIDNKKYYKYSKEKTLKWLEKKVNQTVAALKTNNVNVSSRVQSTAFFSGDQASTDKEEDYIR    141 - 210
YAHGLISDYIPKELSDDLSKYLKLPEPSASLPNPPSKKIKLSDEPVEAKEDYTKFNTKDLKTEKKNSKMT    211 - 280
AAQKALAKVDKSGMKSIDTFFGVKNKKKIGKV                                          281 - 312
//

Text Mined References (27)

PMID Year Title