Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4.90
PubTator Score 9.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -2.100 0.000
osteosarcoma -2.588 0.000
medulloblastoma, large-cell 1.100 0.001
intraductal papillary-mucinous adenoma (... 1.300 0.000
ovarian cancer -1.600 0.000

Synonym

Accession Q5TAQ9 D3DVE6 Q12839 Q4QQI6 Q53F14 Q66K50 Q68CS7 Q96E00
Symbols GAN2
H326
WDR42A

Gene

PANTHER Protein Class (2)

PDB

3I8E  

Gene RIF (4)

PMID Text
24500646 DCAF8 p.R317C mutation is responsible for specific variety of HMSN2 with infrequent giant axons and mild cardiomyopathy.
22500989 WDR42A is a nucleocytoplasmic shuttling protein.
22190034 HIV-1 Vpr is identified to have a physical interaction with DDB1 and CUL4 associated factor 8 (DCAF8; WDR42A) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21424732 while RNF10 and WDR42A or VP22 alone showed distinct subcellular localization patterns, RNF10 and WDR42A were relocated when co-expressed with VP22 or its homologues; these potential host cell factors of VP22 might expand the list of host targets of VP22

AA Sequence

MSSKGSSTDGRTDLANGSLSSSPEEMSGAEEGRETSSGIEVEASDLSLSLTGDDGGPNRTSTESRGTDTE      1 - 70
SSGEDKDSDSMEDTGHYSINDENRVHDRSEEEEEEEEEEEEEQPRRRVQRKRANRDQDSSDDERALEDWV     71 - 140
SSETSALPRPRWQALPALRERELGSSARFVYEACGARVFVQRFRLQHGLEGHTGCVNTLHFNQRGTWLAS    141 - 210
GSDDLKVVVWDWVRRQPVLDFESGHKSNVFQAKFLPNSGDSTLAMCARDGQVRVAELSATQCCKNTKRVA    211 - 280
QHKGASHKLALEPDSPCTFLSAGEDAVVFTIDLRQDRPASKLVVTKEKEKKVGLYTIYVNPANTHQFAVG    281 - 350
GRDQFVRIYDQRKIDENENNGVLKKFCPHHLVNSESKANITCLVYSHDGTELLASYNDEDIYLFNSSHSD    351 - 420
GAQYVKRYKGHRNNATVKGVNFYGPKSEFVVSGSDCGHIFLWEKSSCQIIQFMEGDKGGVVNCLEPHPHL    421 - 490
PVLATSGLDHDVKIWAPTAEASTELTGLKDVIKKNKRERDEDSLHQTDLFDSHMLWFLMHHLRQRRHHRR    491 - 560
WREPGVGATDADSDESPSSSDTSDEEEGPDRVQCMPS                                     561 - 597
//

Text Mined References (19)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24500646 2014 Ubiquitin ligase defect by DCAF8 mutation causes HMSN2 with giant axons.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
22500989 2012 Characterization of nuclear import and export signals determining the subcellular localization of WD repeat-containing protein 42A (WDR42A).
22190034 2011 Global landscape of HIV-human protein complexes.
21424732 2011 Host cell targets of tegument protein VP22 of herpes simplex virus 1.
19060904 2009 An empirical framework for binary interactome mapping.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16964240 2006 Molecular architecture and assembly of the DDB1-CUL4A ubiquitin ligase machinery.
16949367 2006 A family of diverse Cul4-Ddb1-interacting proteins includes Cdt2, which is required for S phase destruction of the replication factor Cdt1.
More...