Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4.90
PubTator Score 9.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... 1.300 3.9e-04
medulloblastoma, large-cell 1.100 6.7e-04
osteosarcoma -2.588 4.3e-07
ovarian cancer -1.600 1.7e-08
psoriasis -1.500 2.6e-10

Gene RIF (4)

AA Sequence

MSSKGSSTDGRTDLANGSLSSSPEEMSGAEEGRETSSGIEVEASDLSLSLTGDDGGPNRTSTESRGTDTE      1 - 70
SSGEDKDSDSMEDTGHYSINDENRVHDRSEEEEEEEEEEEEEQPRRRVQRKRANRDQDSSDDERALEDWV     71 - 140
SSETSALPRPRWQALPALRERELGSSARFVYEACGARVFVQRFRLQHGLEGHTGCVNTLHFNQRGTWLAS    141 - 210
GSDDLKVVVWDWVRRQPVLDFESGHKSNVFQAKFLPNSGDSTLAMCARDGQVRVAELSATQCCKNTKRVA    211 - 280
QHKGASHKLALEPDSPCTFLSAGEDAVVFTIDLRQDRPASKLVVTKEKEKKVGLYTIYVNPANTHQFAVG    281 - 350
GRDQFVRIYDQRKIDENENNGVLKKFCPHHLVNSESKANITCLVYSHDGTELLASYNDEDIYLFNSSHSD    351 - 420
GAQYVKRYKGHRNNATVKGVNFYGPKSEFVVSGSDCGHIFLWEKSSCQIIQFMEGDKGGVVNCLEPHPHL    421 - 490
PVLATSGLDHDVKIWAPTAEASTELTGLKDVIKKNKRERDEDSLHQTDLFDSHMLWFLMHHLRQRRHHRR    491 - 560
WREPGVGATDADSDESPSSSDTSDEEEGPDRVQCMPS                                     561 - 597
//

Text Mined References (19)

PMID Year Title