Property Summary

NCBI Gene PubMed Count 11
Grant Count 1
Funding $91,451.43
PubMed Score 0.87
PubTator Score 0.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.200 0.020
ependymoma -2.400 0.000
glioblastoma -2.000 0.001
atypical teratoid / rhabdoid tumor -2.500 0.000
primitive neuroectodermal tumor -1.500 0.009
adult high grade glioma -1.800 0.000
subependymal giant cell astrocytoma -1.869 0.002

Gene RIF (5)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20511563 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
17531978 Functional analysis of the mouse Ripply2 ortholog.
16326386 Compares Ripply proteins in zebrafish, mouse, human, and amphioxus.

AA Sequence

MENAGGAEGTESGAAACAATDGPTRRAGADSGYAGFWRPWVDAGGKKEEETPNHAAEAMPDGPGMTAASG      1 - 70
KLYQFRHPVRLFWPKSKCYDYLYQEAEALLKNFPIQATISFYEDSDSEDEIEDLTCEN                 71 - 128
//

Text Mined References (13)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26238661 2015 Rare variants in the notch signaling pathway describe a novel type of autosomal recessive Klippel-Feil syndrome.
25416956 2014 A proteome-scale map of the human interactome network.
25343988 2015 Compound heterozygous mutations in RIPPLY2 associated with vertebral segmentation defects.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20511563 2010 Novel cleft susceptibility genes in chromosome 6q.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17531978 2007 Ripply2 is essential for precise somite formation during mouse early development.
16341674 2005 Transcriptome analysis of human gastric cancer.
16326386 2005 Groucho-associated transcriptional repressor ripply1 is required for proper transition from the presomitic mesoderm to somites.
More...