Property Summary

NCBI Gene PubMed Count 21
Grant Count 34
R01 Count 24
Funding $2,146,452.37
PubMed Score 88.81
PubTator Score 45.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell -1.200 0.001
group 4 medulloblastoma -1.100 0.005

 GO Component (1)

Gene RIF (15)

PMID Text
26342546 that suppression of the HES5 leading to inhibition of proliferation may be one of the mechanisms against Hepatocellular carcinoma
25560400 HES5 silencing is an early and recurrent change in prostate tumourigenesis
24548083 these data identify HES5 as a key mediator of the Wnt-3a proneurogenic effect occurring independently of the classical Wnt/beta-catenin signaling cascade thus further deciphering crosstalk mechanisms of Wnt and Notch signaling pathways regulating cell fate
23776410 the downstream Notch signalling effector HES5 directly represses transcription of the E3 ligase Fbw7beta.
23637910 Notch3 and Hes5 are hypermethylated in human B cell acute lymphoblastic leukemia (ALL).
21495212 Hes5 overactivation is associated with cell differentiation, thereby resulting in uterine carcinogenesis.
21238798 In this study, HES 5 transcription factor was detected in the lining epithelium of human periapical cysts with limited inflammation, showing Notch pathway activation in those cells.
20091184 The expression of HES5 in adenocarcinoma was significantly higher than those in adenoma and normal control
18524252 regulates brain development process.[review]
18354251 Data show that HES5 are abundantly expressed in osteoarthritis.
More...

AA Sequence

MAPSTVAVELLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLK      1 - 70
HSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQRPPAAPAAPAKEPKAPGAAP     71 - 140
PPALSAKATAAAAAAHQPACGLWRPW                                                141 - 166
//

Text Mined References (21)

PMID Year Title
26342546 2015 HES5 promotes cell proliferation and invasion through activation of STAT3 and predicts poor survival in hepatocellular carcinoma.
25560400 2015 HES5 silencing is an early and recurrent change in prostate tumourigenesis.
24548083 2014 HES5 is a key mediator of Wnt-3a-induced neuronal differentiation.
23776410 2013 Fbw7 repression by hes5 creates a feedback loop that modulates Notch-mediated intestinal and neural stem cell fate decisions.
23637910 2013 Epigenetic inactivation of Notch-Hes pathway in human B-cell acute lymphoblastic leukemia.
21495212 2010 Hes1/Hes5 gene inhibits differentiation via down-regulating Hash1 and promotes proliferation in cervical carcinoma cells.
21238798 2011 Immunohistochemical expression of Notch signaling in the lining epithelium of periapical cysts.
20091184 2010 The expressions of bHLH gene HES1 and HES5 in advanced ovarian serous adenocarcinomas and their prognostic significance: a retrospective clinical study.
19855400 2009 Notch3 signaling promotes the development of pulmonary arterial hypertension.
19682396 2009 Notch signaling is required for maintaining stem-cell features of neuroprogenitor cells derived from human embryonic stem cells.
More...