Property Summary

NCBI Gene PubMed Count 22
PubMed Score 97.62
PubTator Score 45.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Brain Neoplasms 33 0.0 0.0
Nervous System Diseases 53 0.0 0.0
Disease Target Count
nervous system disorder 53
Disease Target Count P-value
medulloblastoma, large-cell 6241 6.9e-04
group 4 medulloblastoma 1855 5.4e-03

Expression

  Differential Expression (2)

Disease log2 FC p
group 4 medulloblastoma -1.100 5.4e-03
medulloblastoma, large-cell -1.200 6.9e-04

 GO Component (1)

Gene RIF (16)

AA Sequence

MAPSTVAVELLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLK      1 - 70
HSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQRPPAAPAAPAKEPKAPGAAP     71 - 140
PPALSAKATAAAAAAHQPACGLWRPW                                                141 - 166
//

Text Mined References (22)

PMID Year Title