Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.08
PubTator Score 0.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
diabetes mellitus 1728 1.5e-03

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.800 1.5e-03

Gene RIF (1)

AA Sequence

MSCQQNQQQCQPPPKCPPKCTPKCPPKCPPKCPPQCPAPCSPAVSSCCGPSSGSCCGPSSGGCCSSGGGG      1 - 70
CCLSHHRPRLFHRRRHQSPDCCESEPSGASGCCHSSGGCC                                   71 - 110
//

Text Mined References (6)

PMID Year Title