Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.08
PubTator Score 0.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
diabetes mellitus 1,663

Gene RIF (1)

PMID Text
15854049 paper describing nomenclature changes and expression in range of tissues and in response to UV

AA Sequence

MSCQQNQQQCQPPPKCPPKCTPKCPPKCPPKCPPQCPAPCSPAVSSCCGPSSGSCCGPSSGGCCSSGGGG      1 - 70
CCLSHHRPRLFHRRRHQSPDCCESEPSGASGCCHSSGGCC                                   71 - 110
//

Text Mined References (6)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15854049 2005 Late cornified envelope family in differentiating epithelia--response to calcium and ultraviolet irradiation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11698679 2001 Differentially expressed late constituents of the epidermal cornified envelope.