Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
15854049 paper describing nomenclature changes and expression in range of tissues and in response to UV

AA Sequence

MSCQQNQQQCQPPPKCPPKCTPKCPPKCPPKCPPQCPAPCFPAVSSCCGPSSGSCCGPSSGGCCSSGAGG      1 - 70
CSLSHHRPRLFHRRRHQSPDCCESEPSGGSGCCHSSGGCC                                   71 - 110
//

Text Mined References (4)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15854049 2005 Late cornified envelope family in differentiating epithelia--response to calcium and ultraviolet irradiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11698679 2001 Differentially expressed late constituents of the epidermal cornified envelope.