Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
diabetes mellitus 1728 1.3e-03

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.700 1.3e-03

Gene RIF (1)

AA Sequence

MSCQQNQQQCQPPPKCPPKCPPKCPPKCRPQCPAPCPPPVSSCCGPSSGGCCGSSSGGCCSSGGGGCCLS      1 - 70
HHRPRLFHRHRHQSPDCCECEPSGGSGCCHSSGDCC                                       71 - 106
//

Text Mined References (7)

PMID Year Title