Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.33

Knowledge Summary

Patent

No data available

Gene RIF (2)

PMID Text
25197941 SNPs in LCE4A are associated with increased risk of candidemia.
15854049 paper describing nomenclature changes and expression in range of tissues and in response to UV

AA Sequence

MSCQQNQQQCQPPPKCPIPKYPPKCPSKCASSCPPPISSCCGSSSGGCGCCSSEGGGCCLSHHRHHRSHC      1 - 70
HRPKSSNCYGSGSGQQSGGSGCCSGGGCC                                              71 - 99
//

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25197941 2014 Immunochip SNP array identifies novel genetic variants conferring susceptibility to candidaemia.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15854049 2005 Late cornified envelope family in differentiating epithelia--response to calcium and ultraviolet irradiation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11698679 2001 Differentially expressed late constituents of the epidermal cornified envelope.