Property Summary

NCBI Gene PubMed Count 5
PubMed Score 40.19
PubTator Score 8.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung adenocarcinoma 2627 1.6e-06
non primary Sjogren syndrome sicca 861 2.1e-02
Disease Target Count Z-score Confidence
Ovarian carcinoma 3 3.056 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
lung adenocarcinoma 1.500 1.6e-06
non primary Sjogren syndrome sicca 1.300 2.1e-02

Gene RIF (3)

AA Sequence

MDDSETGFNLKVVLVSFKQCLDEKEEVLLDPYIASWKGLVRFLNSLGTIFSFISKDVVSKLRIMERLRGG      1 - 70
PQSEHYRSLQAMVAHELSNRLVDLERRSHHPESGCRTVLRLHRALHWLQLFLEGLRTSPEDARTSALCAD     71 - 140
SYNASLAAYHPWVVRRAVTVAFCTLPTREVFLEAMNVGPPEQAVQMLGEALPFIQRVYNVSQKLYAEHSL    141 - 210
LDLP                                                                      211 - 214
//

Text Mined References (8)

PMID Year Title