Property Summary

NCBI Gene PubMed Count 18
PubMed Score 6.42
PubTator Score 5.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
astrocytic glioma 2597 3.6e-02
oligodendroglioma 2850 4.4e-02
Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 3.0

Expression

  Differential Expression (2)

Disease log2 FC p
astrocytic glioma -1.200 3.6e-02
oligodendroglioma -1.100 4.4e-02

 GO Function (1)

Gene RIF (3)

AA Sequence

MPEIRVTPLGAGQDVGRSCILVSIAGKNVMLDCGMHMGFNDDRRFPDFSYITQNGRLTDFLDCVIISHFH      1 - 70
LDHCGALPYFSEMVGYDGPIYMTHPTQAICPILLEDYRKIAVDKKGEANFFTSQMIKDCMKKVVAVHLHQ     71 - 140
TVQVDDELEIKAYYAGHVLGAAMFQIKVGSESVVYTGDYNMTPDRHLGAAWIDKCRPNLLITESTYATTI    141 - 210
RDSKRCRERDFLKKVHETVERGGKVLIPVFALGRAQELCILLETFWERMNLKVPIYFSTGLTEKANHYYK    211 - 280
LFIPWTNQKIRKTFVQRNMFEFKHIKAFDRAFADNPGPMVVFATPGMLHAGQSLQIFRKWAGNEKNMVIM    281 - 350
PGYCVQGTVGHKILSGQRKLEMEGRQVLEVKMQVEYMSFSAHADAKGIMQLVGQAEPESVLLVHGEAKKM    351 - 420
EFLKQKIEQELRVNCYMPANGETVTLPTSPSIPVGISLGLLKREMAQGLLPEAKKPRLLHGTLIMKDSNF    421 - 490
RLVSSEQALKELGLAEHQLRFTCRVHLHDTRKEQETALRVYSHLKSVLKDHCVQHLPDGSVTVESVLLQA    491 - 560
AAPSEDPGTKVLLVSWTYQDEELGSFLTSLLKKGLPQAPS                                  561 - 600
//

Text Mined References (19)

PMID Year Title