Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.46
PubTator Score 1.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 6.9e-03
Multiple myeloma 1332 3.5e-02
Breast cancer 3578 4.3e-02

Expression

  Differential Expression (3)

Disease log2 FC p
Breast cancer 2.200 4.3e-02
Multiple myeloma 1.057 3.5e-02
osteosarcoma -1.010 6.9e-03

Gene RIF (2)

AA Sequence

MALPAGPAEAACALCQRAPREPVRADCGHRFCRACVVRFWAEEDGPFPCPECADDCWQRAVEPGRPPLSR      1 - 70
RLLALEEAAAAPARDGPASEAALQLLCRADAGPLCAACRMAAGPEPPEWEPRWRKALRGKENKGSVEIMR     71 - 140
KDLNDARDLHGQAESAAAVWKGHVMDRRKKALTDYKKLRAFFVEEEEHFLQEAEKEEGLPEDELADPTER    141 - 210
FRSLLQAVSELEKKHRNLGLSMLLQ                                                 211 - 235
//

Text Mined References (8)

PMID Year Title