Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.70
PubTator Score 1.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.057 0.035
osteosarcoma -1.010 0.007
Breast cancer 2.200 0.043

Synonym

Accession Q5TA31 A6NL57 Q6P2J7 Q6PJR0
Symbols RACO1
RACO-1

Gene

Gene RIF (2)

PMID Text
23624934 Arginine methylation of RACO-1 is required for efficient transcriptional activation by c-Jun/AP-1 and thus identify PRMT1 as an important regulator of c-Jun/AP-1 function.
20852630 The RACO-1(RING domain AP-1 co-activator-1) is a co-activator that links c-Jun to growth factor signalling and is essential for AP-1 function in proliferation

AA Sequence

MALPAGPAEAACALCQRAPREPVRADCGHRFCRACVVRFWAEEDGPFPCPECADDCWQRAVEPGRPPLSR      1 - 70
RLLALEEAAAAPARDGPASEAALQLLCRADAGPLCAACRMAAGPEPPEWEPRWRKALRGKENKGSVEIMR     71 - 140
KDLNDARDLHGQAESAAAVWKGHVMDRRKKALTDYKKLRAFFVEEEEHFLQEAEKEEGLPEDELADPTER    141 - 210
FRSLLQAVSELEKKHRNLGLSMLLQ                                                 211 - 235
//

Text Mined References (6)

PMID Year Title
24057671 2014 Genome-wide association study of ancestry-specific TB risk in the South African Coloured population.
23624934 2013 Arginine methylation of the c-Jun coactivator RACO-1 is required for c-Jun/AP-1 activation.
20852630 2010 Identification of a co-activator that links growth factor signalling to c-Jun/AP-1 activation.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.