Property Summary

NCBI Gene PubMed Count 0
PubMed Score 3.15
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
Breast cancer -1.100 0.000
psoriasis 1.100 0.000

AA Sequence

MILKGCLLYPLCSPRNKQRCARLWKIAYGGLLKIVTGSLLTFYVVLCLDGGMVLMRKQVPSRFMYPKEWQ      1 - 70
HLTMFILLTLNGCVDFMSKNVLPQRCVGLEKGTLVLIIYELLLLMVSHVKDSEGVELHVYSLLILVVFLL     71 - 140
LLVLTAELWAPNMCHLQLMETFLILMMGSWLMQAGFILYRPVSGYPWQDDDISDIMFVTTFFCWHVMINA    141 - 210
SFLLGIYGFSSFWYHCFRPSLKLTGPKEAPYYASTPGPLYKLLQEVEQSEKEDQALLLPKSSP           211 - 273
//

Text Mined References (1)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.