Property Summary

NCBI Gene PubMed Count 34
PubMed Score 285.29
PubTator Score 75.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
breast carcinoma 1614 1.5781072515643E-37
glioblastoma multiforme 347 1.03861899633396E-24
ependymoma 2514 1.12107254347371E-17
juvenile dermatomyositis 1189 4.10668841323293E-12
psoriasis 6685 4.01095930796773E-10
pilocytic astrocytoma 3086 6.13493980063189E-10
malignant mesothelioma 3163 1.53885198702791E-8
Duchenne muscular dystrophy 602 7.34061494510752E-8
atypical teratoid/rhabdoid tumor 1095 2.2452790625228E-7
Breast cancer 3099 2.43433625965563E-7
tuberculosis 1563 2.8470172831887E-7
ovarian cancer 8492 1.04236017764479E-4
medulloblastoma, large-cell 6234 2.19763630970922E-4
invasive ductal carcinoma 2950 5.62218494104082E-4
lung cancer 4473 6.6978005227454E-4
pediatric high grade glioma 2712 0.00108487895932227
cystic fibrosis 1670 0.00125789574794782
astrocytoma 1493 0.00162863068371687
interstitial cystitis 2299 0.00396654481855208
group 4 medulloblastoma 1875 0.0044407147097075
subependymal giant cell astrocytoma 2287 0.00604116142790064
pituitary cancer 1972 0.00631343328255428
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00836271319783019
chronic rhinosinusitis 512 0.00865131537163251
nasopharyngeal carcinoma 1056 0.0184841307840791
osteosarcoma 7933 0.0204853699855419
primary pancreatic ductal adenocarcinoma 1271 0.0238495207662073
mucosa-associated lymphoid tissue lymphoma 480 0.0304350526663297
Disease Target Count Z-score Confidence
Nasopharynx carcinoma 19 0.0 1.0
Osteoporosis 259 0.0 2.0

Expression

Synonym

Accession Q5T9L3 B2RNT2 Q5JRS7 Q7Z2Z9 Q8NC43
Symbols EVI
MRP
GPR177
mig-14
C1orf139

Gene

WLS

  Ortholog (13)

Gene RIF (16)

PMID Text
26911590 Genetic variation at the WLS and CCDC170/ESR1 loci were found to be significantly associated with bone mineral density
25551557 This study identified CMTM8 as a new candidate tumor suppressor gene and GPR177 as a new candidate oncogene in osteosarcoma.
25258105 This study has revealed a strong association between the expression of WLS and HER2 that has important biological and clinical implications.
25115440 GPR177 played an essential role in disease relapse and poor survival in patients with B-cell precursor acute lymphoblastic leukemia.
24768165 endogenous WLS binds Wnts in the endoplasmic reticulum, cycles to the plasma membrane, and then returns to the endoplasmic reticulum through the Golgi.
24162018 Colorectal tumors express elevated levels of Wnt3 and GPR177.
23918954 Evi expression in psoriatic skin biopsies is down-regulated, suggesting that Evi-deficient mice developed skin lesions that resemble human psoriasis.
23566366 The data suggest that the common variants of WLS analyzed in this study are not associated with opioid or cocaine addiction.
23188710 findings lead to a proposed mechanism by which Gpr177 controls skeletal development through modulation of autocrine and paracrine Wnt signals in a lineage-specific fashion
23129487 WLS functions as a negative regulator of melanoma proliferation and spontaneous metastasis by activating WNT/beta-catenin signalling.
More...

AA Sequence

MAGAIIENMSTKKLCIVGGILLVFQIIAFLVGGLIAPGPTTAVSYMSVKCVDARKNHHKTKWFVPWGPNH      1 - 70
CDKIRDIEEAIPREIEANDIVFSVHIPLPHMEMSPWFQFMLFILQLDIAFKLNNQIRENAEVSMDVSLAY     71 - 140
RDDAFAEWTEMAHERVPRKLKCTFTSPKTPEHEGRYYECDVLPFMEIGSVAHKFYLLNIRLPVNEKKKIN    141 - 210
VGIGEIKDIRLVGIHQNGGFTKVWFAMKTFLTPSIFIIMVWYWRRITMMSRPPVLLEKVIFALGISMTFI    211 - 280
NIPVEWFSIGFDWTWMLLFGDIRQGIFYAMLLSFWIIFCGEHMMDQHERNHIAGYWKQVGPIAVGSFCLF    281 - 350
IFDMCERGVQLTNPFYSIWTTDIGTELAMAFIIVAGICLCLYFLFLCFMVFQVFRNISGKQSSLPAMSKV    351 - 420
RRLHYEGLIFRFKFLMLITLACAAMTVIFFIVSQVTEGHWKWGGVTVQVNSAFFTGIYGMWNLYVFALMF    421 - 490
LYAPSHKNYGEDQSNGDLGVHSGEELQLTTTITHVDGPTEIYKLTRKEAQE                       491 - 541
//

Text Mined References (37)

PMID Year Title
26911590 2016 Genome-wide association study using family-based cohorts identifies the WLS and CCDC170/ESR1 loci as associated with bone mineral density.
25551557 2014 Focal chromosomal copy number aberrations identify CMTM8 and GPR177 as new candidate driver genes in osteosarcoma.
25258105 2015 Analysis of wntless (WLS) expression in gastric, ovarian, and breast cancers reveals a strong association with HER2 overexpression.
25115440 2014 Wntless (GPR177) expression correlates with poor prognosis in B-cell precursor acute lymphoblastic leukemia via Wnt signaling.
24768165 2014 WLS retrograde transport to the endoplasmic reticulum during Wnt secretion.
24249740 2014 Multistage genome-wide association meta-analyses identified two new loci for bone mineral density.
24162018 2013 Wnt secretion is required to maintain high levels of Wnt activity in colon cancer cells.
23918954 2013 Loss of epidermal Evi/Wls results in a phenotype resembling psoriasiform dermatitis.
23840749 2013 MOR is not enough: identification of novel mu-opioid receptor interacting proteins using traditional and modified membrane yeast two-hybrid screens.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
More...