Property Summary

NCBI Gene PubMed Count 34
Grant Count 74
R01 Count 35
Funding $21,767,652.88
PubMed Score 285.29
PubTator Score 75.89

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q5T9L3 B2RNT2 Q5JRS7 Q7Z2Z9 Q8NC43
Symbols EVI
MRP
GPR177
mig-14
C1orf139

Gene

WLS

Gene RIF (16)

PMID Text
26911590 Genetic variation at the WLS and CCDC170/ESR1 loci were found to be significantly associated with bone mineral density
25551557 This study identified CMTM8 as a new candidate tumor suppressor gene and GPR177 as a new candidate oncogene in osteosarcoma.
25258105 This study has revealed a strong association between the expression of WLS and HER2 that has important biological and clinical implications.
25115440 GPR177 played an essential role in disease relapse and poor survival in patients with B-cell precursor acute lymphoblastic leukemia.
24768165 endogenous WLS binds Wnts in the endoplasmic reticulum, cycles to the plasma membrane, and then returns to the endoplasmic reticulum through the Golgi.
24162018 Colorectal tumors express elevated levels of Wnt3 and GPR177.
23918954 Evi expression in psoriatic skin biopsies is down-regulated, suggesting that Evi-deficient mice developed skin lesions that resemble human psoriasis.
23566366 The data suggest that the common variants of WLS analyzed in this study are not associated with opioid or cocaine addiction.
23188710 findings lead to a proposed mechanism by which Gpr177 controls skeletal development through modulation of autocrine and paracrine Wnt signals in a lineage-specific fashion
23129487 WLS functions as a negative regulator of melanoma proliferation and spontaneous metastasis by activating WNT/beta-catenin signalling.
More...

AA Sequence

MAGAIIENMSTKKLCIVGGILLVFQIIAFLVGGLIAPGPTTAVSYMSVKCVDARKNHHKTKWFVPWGPNH      1 - 70
CDKIRDIEEAIPREIEANDIVFSVHIPLPHMEMSPWFQFMLFILQLDIAFKLNNQIRENAEVSMDVSLAY     71 - 140
RDDAFAEWTEMAHERVPRKLKCTFTSPKTPEHEGRYYECDVLPFMEIGSVAHKFYLLNIRLPVNEKKKIN    141 - 210
VGIGEIKDIRLVGIHQNGGFTKVWFAMKTFLTPSIFIIMVWYWRRITMMSRPPVLLEKVIFALGISMTFI    211 - 280
NIPVEWFSIGFDWTWMLLFGDIRQGIFYAMLLSFWIIFCGEHMMDQHERNHIAGYWKQVGPIAVGSFCLF    281 - 350
IFDMCERGVQLTNPFYSIWTTDIGTELAMAFIIVAGICLCLYFLFLCFMVFQVFRNISGKQSSLPAMSKV    351 - 420
RRLHYEGLIFRFKFLMLITLACAAMTVIFFIVSQVTEGHWKWGGVTVQVNSAFFTGIYGMWNLYVFALMF    421 - 490
LYAPSHKNYGEDQSNGDLGVHSGEELQLTTTITHVDGPTEIYKLTRKEAQE                       491 - 541
//

Text Mined References (37)

PMID Year Title
26911590 2016 Genome-wide association study using family-based cohorts identifies the WLS and CCDC170/ESR1 loci as associated with bone mineral density.
25551557 2014 Focal chromosomal copy number aberrations identify CMTM8 and GPR177 as new candidate driver genes in osteosarcoma.
25258105 2015 Analysis of wntless (WLS) expression in gastric, ovarian, and breast cancers reveals a strong association with HER2 overexpression.
25115440 2014 Wntless (GPR177) expression correlates with poor prognosis in B-cell precursor acute lymphoblastic leukemia via Wnt signaling.
24768165 2014 WLS retrograde transport to the endoplasmic reticulum during Wnt secretion.
24249740 2014 Multistage genome-wide association meta-analyses identified two new loci for bone mineral density.
24162018 2013 Wnt secretion is required to maintain high levels of Wnt activity in colon cancer cells.
23918954 2013 Loss of epidermal Evi/Wls results in a phenotype resembling psoriasiform dermatitis.
23840749 2013 MOR is not enough: identification of novel mu-opioid receptor interacting proteins using traditional and modified membrane yeast two-hybrid screens.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
More...