Property Summary

NCBI Gene PubMed Count 38
PubMed Score 316.27
PubTator Score 75.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count
addicted to cocaine 4
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Nasopharynx carcinoma 18 0.0 1.4
Osteoporosis 363 0.0 3.0

Expression

  Differential Expression (28)

Disease log2 FC p
adult high grade glioma 1.200 5.5e-03
astrocytic glioma 1.800 7.4e-03
Astrocytoma, Pilocytic 1.600 3.1e-06
atypical teratoid / rhabdoid tumor 1.500 4.5e-03
Breast cancer -2.600 2.4e-07
breast carcinoma -1.800 3.0e-32
chronic rhinosinusitis -1.310 8.7e-03
cystic fibrosis 1.200 1.3e-03
Duchenne muscular dystrophy 1.166 7.3e-08
ependymoma 2.500 6.6e-03
glioblastoma 1.200 1.6e-03
group 4 medulloblastoma -1.300 4.3e-02
interstitial cystitis -1.100 4.0e-03
intraductal papillary-mucinous carcinoma... -1.300 5.0e-02
invasive ductal carcinoma -2.300 5.6e-04
juvenile dermatomyositis 1.567 4.1e-12
lung cancer -1.100 4.1e-03
malignant mesothelioma -2.500 1.5e-08
medulloblastoma, large-cell -2.100 5.7e-03
mucosa-associated lymphoid tissue lympho... 1.400 3.0e-02
nasopharyngeal carcinoma -1.100 1.8e-02
osteosarcoma 1.482 2.0e-02
ovarian cancer -2.400 3.8e-04
pituitary cancer 1.500 6.3e-03
primary pancreatic ductal adenocarcinoma 1.117 2.4e-02
psoriasis -1.300 4.0e-10
subependymal giant cell astrocytoma 2.375 6.0e-03
tuberculosis 1.600 2.5e-06

Gene RIF (20)

AA Sequence

MAGAIIENMSTKKLCIVGGILLVFQIIAFLVGGLIAPGPTTAVSYMSVKCVDARKNHHKTKWFVPWGPNH      1 - 70
CDKIRDIEEAIPREIEANDIVFSVHIPLPHMEMSPWFQFMLFILQLDIAFKLNNQIRENAEVSMDVSLAY     71 - 140
RDDAFAEWTEMAHERVPRKLKCTFTSPKTPEHEGRYYECDVLPFMEIGSVAHKFYLLNIRLPVNEKKKIN    141 - 210
VGIGEIKDIRLVGIHQNGGFTKVWFAMKTFLTPSIFIIMVWYWRRITMMSRPPVLLEKVIFALGISMTFI    211 - 280
NIPVEWFSIGFDWTWMLLFGDIRQGIFYAMLLSFWIIFCGEHMMDQHERNHIAGYWKQVGPIAVGSFCLF    281 - 350
IFDMCERGVQLTNPFYSIWTTDIGTELAMAFIIVAGICLCLYFLFLCFMVFQVFRNISGKQSSLPAMSKV    351 - 420
RRLHYEGLIFRFKFLMLITLACAAMTVIFFIVSQVTEGHWKWGGVTVQVNSAFFTGIYGMWNLYVFALMF    421 - 490
LYAPSHKNYGEDQSNGDLGVHSGEELQLTTTITHVDGPTEIYKLTRKEAQE                       491 - 541
//

Text Mined References (41)

PMID Year Title