Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.75
PubTator Score 2.81

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
19680787 These studies indicate a functional negative correlation between elevated levels of PIP5KL1 and the development of human gastric cancer.
14701839 PIPKH acts as a scaffold to localize and regulate type I PI(4)P 5-kinases and the synthesis of PI(3,4,5)P(3)

AA Sequence

MAAPSPGPREVLAPSPEAGCRAVTSSRRGLLWRLRDKQSRLGLFEISPGHELHGMTCMMQAGLWAATQVS      1 - 70
MDHPPTGPPSRDDFSEVLTQVHEGFELGTLAGPAFAWLRRSLGLAEEDYQAALGPGGPYLQFLSTSKSKA     71 - 140
SFFLSHDQRFFLKTQGRREVQALLAHLPRYVQHLQRHPHSLLARLLGVHSLRVDRGKKTYFIVMQSVFYP    141 - 210
AGRISERYDIKGCEVSRWVDPAPEGSPLVLVLKDLNFQGKTINLGPQRSWFLRQMELDTTFLRELNVLDY    211 - 280
SLLIAFQRLHEDERGPGSSLIFRTARSVQGAQSPEESRAQNRRLLPDAPNALHILDGPEQRYFLGVVDLA    281 - 350
TVYGLRKRLEHLWKTLRYPGRTFSTVSPARYARRLCQWVEAHTE                              351 - 394
//

Text Mined References (6)

PMID Year Title
19680787 2010 Overexpression of PIP5KL1 suppresses cell proliferation and migration in human gastric cancer cells.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14701839 2004 Identification and characterization of a phosphoinositide phosphate kinase homolog.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.