Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.75
PubTator Score 2.81

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q5T9C9 Q8IVS3 PI(4)P 5-kinase-like protein 1
Symbols PIPKH
bA203J24.5

Gene

PANTHER Protein Class (2)

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Xenopus OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
19680787 These studies indicate a functional negative correlation between elevated levels of PIP5KL1 and the development of human gastric cancer.
14701839 PIPKH acts as a scaffold to localize and regulate type I PI(4)P 5-kinases and the synthesis of PI(3,4,5)P(3)

AA Sequence

MAAPSPGPREVLAPSPEAGCRAVTSSRRGLLWRLRDKQSRLGLFEISPGHELHGMTCMMQAGLWAATQVS      1 - 70
MDHPPTGPPSRDDFSEVLTQVHEGFELGTLAGPAFAWLRRSLGLAEEDYQAALGPGGPYLQFLSTSKSKA     71 - 140
SFFLSHDQRFFLKTQGRREVQALLAHLPRYVQHLQRHPHSLLARLLGVHSLRVDRGKKTYFIVMQSVFYP    141 - 210
AGRISERYDIKGCEVSRWVDPAPEGSPLVLVLKDLNFQGKTINLGPQRSWFLRQMELDTTFLRELNVLDY    211 - 280
SLLIAFQRLHEDERGPGSSLIFRTARSVQGAQSPEESRAQNRRLLPDAPNALHILDGPEQRYFLGVVDLA    281 - 350
TVYGLRKRLEHLWKTLRYPGRTFSTVSPARYARRLCQWVEAHTE                              351 - 394
//

Text Mined References (6)

PMID Year Title
19680787 2010 Overexpression of PIP5KL1 suppresses cell proliferation and migration in human gastric cancer cells.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14701839 2004 Identification and characterization of a phosphoinositide phosphate kinase homolog.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.