Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.03
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
sonic hedgehog group medulloblastoma -1.600 0.000
atypical teratoid/rhabdoid tumor -1.500 0.000
medulloblastoma, large-cell -1.900 0.000
tuberculosis -1.700 0.000
breast carcinoma 1.700 0.001
lung carcinoma 1.600 0.000
ovarian cancer -1.300 0.000

Synonym

Accession Q5T9C2 A2A329 Q8TEL4
Symbols EEIG1
SYM-3A
C9orf132
bA203J24.7

Gene

 Compartment GO Term (0)

Gene RIF (2)

PMID Text
23478294 EEIG1 is a novel RANK signaling component controlling RANK-mediated osteoclast formation.
14605097 A novel estrogen-responsive gene was identified and named EEIG1 for early estrogen-induced gene 1

AA Sequence

MAFLMKKKKFKFQTTFTLEELTAVPFVNGVLFCKVRLLDGGDFVSLSSREEVQENCVRWRKRFTFVCKMS      1 - 70
ANPATGLLDPCVFRVSVRKELKGGKAYSKLGFADLNLAEFAGSGSTVRCCLLEGYDTKNTRQDNSILKVT     71 - 140
IGMFLLSGDPCFKTPPSTAKSISIPGQDSSLQLTCKGGGTSSGGSSTNSLTGSRPPKARPTILSSGLPEE    141 - 210
PDQNLSSPEEVFHSGHSRNSSYASQQSKISGYSTEHSRSSSLSDLTHRRNTSTSSSASGGLGMTVEGPEG    211 - 280
SEREHRPPEKPPRPPRPLHLSDRSFRRKKDSVESHPTWVDDTRIDADAIVEKIVQSQDFTDGSNTEDSNL    281 - 350
RLFVSRDGSATLSGIQLATRVSSGVYEPVVIESH                                        351 - 384
//

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23478294 2013 Early estrogen-induced gene 1, a novel RANK signaling component, is essential for osteoclastogenesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14605097 2004 Identification of estrogen-responsive genes by complementary deoxyribonucleic acid microarray and characterization of a novel early estrogen-induced gene: EEIG1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.