Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.89
PubTator Score 1.33

Knowledge Summary


No data available


  Disease (3)


  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 2.8e-07
breast carcinoma 1.700 1.5e-03
group 3 medulloblastoma -1.200 1.0e-04
lung carcinoma 1.600 1.5e-22
medulloblastoma, large-cell -1.900 2.0e-05
ovarian cancer -1.300 1.1e-06
tuberculosis -1.700 4.3e-05

Gene RIF (2)

AA Sequence

RLFVSRDGSATLSGIQLATRVSSGVYEPVVIESH                                        351 - 384

Text Mined References (7)

PMID Year Title