Property Summary

NCBI Gene PubMed Count 15
PubMed Score 7.27
PubTator Score 7.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung adenocarcinoma 2716 5.0e-09
Disease Target Count Z-score Confidence
Branchiootic syndrome 12 3.595 1.8
Pontocerebellar hypoplasia 36 3.32 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
lung adenocarcinoma 1.100 5.0e-09

 GO Function (1)

 GO Process (1)

Gene RIF (10)

AA Sequence

MSWLFGVNKGPKGEGAGPPPPLPPAQPGAEGGGDRGLGDRPAPKDKWSNFDPTGLERAAKAARELEHSRY      1 - 70
AKEALNLAQMQEQTLQLEQQSKLKEYEAAVEQLKSEQIRAQAEERRKTLSEETRQHQARAQYQDKLARQR     71 - 140
YEDQLKQQQLLNEENLRKQEESVQKQEAMRRATVEREMELRHKNEMLRVETEARARAKAERENADIIREQ    141 - 210
IRLKASEHRQTVLESIRTAGTLFGEGFRAFVTDRDKVTATVAGLTLLAVGVYSAKNATAVTGRFIEARLG    211 - 280
KPSLVRETSRITVLEALRHPIQVSRRLLSRPQDVLEGVVLSPSLEARVRDIAIATRNTKKNRGLYRHILL    281 - 350
YGPPGTGKTLFAKKLALHSGMDYAIMTGGDVAPMGREGVTAMHKLFDWANTSRRGLLLFMDEADAFLRKR    351 - 420
ATEEISKDLRATLNAFLYHMGQHSNKFMLVLASNLPEQFDCAINSRIDVMVHFDLPQQEERERLVRLHFD    421 - 490
NCVLKPATEGKRRLKLAQFDYGRKCSEVARLTEGMSGREIAQLAVSWQATAYASKDGVLTEAMMDACVQD    491 - 560
AVQQYRQKMRWLKAEGPGRGVEHPLSGVQGETLTSWSLATDPSYPCLAGPCTFRICSWMGTGLCPGPLSP    561 - 630
RMSCGGGRPFCPPGHPLL                                                        631 - 648
//

Text Mined References (20)

PMID Year Title