Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.32
PubTator Score 0.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 1.787 0.000
primary pancreatic ductal adenocarcinoma 1.698 0.000
intraductal papillary-mucinous neoplasm ... 1.200 0.032
Breast cancer 2.900 0.027
lung adenocarcinoma 1.700 0.000
ovarian cancer 1.600 0.000
pancreatic cancer 1.400 0.003

Synonym

Accession Q5T953 Q6P3E2
Symbols bA247A12.2

Gene

 Compartment GO Term (0)

AA Sequence

MECALDAQSLISISLRKIHSSRTQRGGIKLHKNLLVSYVLRNARQLYLSERYAELYRRQQQQQQQQPPHH      1 - 70
QHQHLAYAAPGMPASAADFGPLQLGGGGDAEAREPAARHQLHQLHQLHQLHLQQQLHQHQHPAPRGCAAA     71 - 140
AAAGAPAGGAGALSELPGCAALQPPHGAPHRGQPLEPLQPGPAPLPLPLPPPAPAALCPRDPRAPAACSA    141 - 210
PPGAAPPAAAASPPASPAPASSPGFYRGAYPTPSDFGLHCSSQTTVLDLDTHVVTTVENGYLHQDCCASA    211 - 280
HCPCCGQGAPGPGLASAAGCKRKYYPGQEEEEDDEEDAGGLGAEPPGGAPFAPCKRARFEDFCPDSSPDA    281 - 350
SNISNLISIFGSGFSGLVSRQPDSSEQPPPLNGQLCAKQALASLGAWTRAIVAF                    351 - 404
//

Text Mined References (6)

PMID Year Title
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.