Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Synonym

Accession Q5T8R8 Q96NB0
Symbols

Gene

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
18976975 Knockdown of chromosome 9 open reading frame 66 (C9orf66) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MRHSVARPTRLPRRLSPFWDPATCKNLEGGAGEVVRGRDPRRLRTSRSTEILGEDLAGPSAGAAARPAAP      1 - 70
PPQPREPGAPGLRRAPPRTRMDSSGLGPCSEAPLHTSAGLSGRNLRAAGGVLPVDLERERAALCARQSGH     71 - 140
GPPAVRWLLGSRGAESGGLARRRVAAEHAQPSANLVCRSALETSAFPPSKPKSPRGRVRARSSDGRLRHP    141 - 210
AWRAGSGGRGGRGPSAELASRYWGRRRALPGAADLRPKGARADDRRPLRAGRKLHLPEAARLPGNVGKSG    211 - 280
EPHKAGEVGNHPRDS                                                           281 - 295
//

Text Mined References (3)

PMID Year Title
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.