Property Summary

NCBI Gene PubMed Count 15
PubMed Score 0.70
PubTator Score 0.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
juvenile dermatomyositis 1189 1.39307326684257E-8
ovarian cancer 8492 1.2878353246713E-7
osteosarcoma 7933 2.81053014426166E-7
glioblastoma 5572 1.89007076628277E-5
tuberculosis and treatment for 6 months 686 2.66665966147276E-5
Pick disease 1893 2.22542226481199E-4
dermatomyositis 967 7.41065882312039E-4
malignant mesothelioma 3163 0.00105363535891625
ependymoma 2514 0.012109151676281
progressive supranuclear palsy 674 0.0166806537519159
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.022866504311633
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0278712734799083
oligodendroglioma 2849 0.0356095671958773
Disease Target Count Z-score Confidence
Costello Syndrome 18 3.942 2.0
Beckwith-Wiedemann syndrome 46 3.356 1.7

Expression

  Differential Expression (13)

Synonym

Accession Q5T8P6 B4DZE0 Q2NKM2 Q2NKQ2 Q5CZH8 Q5T8P5 Q5T8P8 Q5U5P5 Q5W0G7 Q8N3H5 Q96K92 Q96SZ3 Q9H2F8 Q9H7F9 Q9P1G7
Symbols ARRS2
SE70-2
ZC3H17
PRO1777
C13orf10
PPP1R132

Gene

  Ortholog (12)

Pathway (1)

Gene RIF (2)

PMID Text
25631074 Cellular biotinylated RNA binding motif protein 26 (RBM26) is incorporated into HIV-1 Gag virus-like particles
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MVSKMIIENFEALKSWLSKTLEPICDADPSALAKYVLALVKKDKSEKELKALCIDQLDVFLQKETQIFVE      1 - 70
KLFDAVNTKSYLPPPEQPSSGSLKVEFFPHQEKDIKKEEITKEEEREKKFSRRLNHSPPQSSSRYRENRS     71 - 140
RDERKKDDRSRKRDYDRNPPRRDSYRDRYNRRRGRSRSYSRSRSRSWSKERLRERDRDRSRTRSRSRTRS    141 - 210
RERDLVKPKYDLDRTDPLENNYTPVSSVPSISSGHYPVPTLSSTITVIAPTHHGNNTTESWSEFHEDQVD    211 - 280
HNSYVRPPMPKKRCRDYDEKGFCMRGDMCPFDHGSDPVVVEDVNLPGMLPFPAQPPVVEGPPPPGLPPPP    281 - 350
PILTPPPVNLRPPVPPPGPLPPSLPPVTGPPPPLPPLQPSGMDAPPNSATSSVPTVVTTGIHHQPPPAPP    351 - 420
SLFTADTYDTDGYNPEAPSITNTSRPMYRHRVHAQRPNLIGLTSGDMDLPPREKPPNKSSMRIVVDSESR    421 - 490
KRTIGSGEPGVPTKKTWFDKPNFNRTNSPGFQKKVQFGNENTKLELRKVPPELNNISKLNEHFSRFGTLV    491 - 560
NLQVAYNGDPEGALIQFATYEEAKKAISSTEAVLNNRFIKVYWHREGSTQQLQTTSPKVMQPLVQQPILP    561 - 630
VVKQSVKERLGPVPSSTIEPAEAQSASSDLPQNVTKLSVKDRLGFVSKPSVSATEKVLSTSTGLTKTVYN    631 - 700
PAALKAAQKTLLVSTSAVDNNEAQKKKQEALKLQQDVRKRKQEILEKHIETQKMLISKLEKNKTMKSEDK    701 - 770
AEIMKTLEVLTKNITKLKDEVKAASPGRCLPKSIKTKTQMQKELLDTELDLYKKMQAGEEVTELRRKYTE    771 - 840
LQLEAAKRGILSSGRGRGIHSRGRGAVHGRGRGRGRGRGVPGHAVVDHRPRALEISAFTESDREDLLPHF    841 - 910
AQYGEIEDCQIDDSSLHAVITFKTRAEAEAAAVHGARFKGQDLKLAWNKPVTNISAVETEEVEPDEEEFQ    911 - 980
EESLVDDSLLQDDDEEEEDNESRSWRR                                               981 - 1007
//

Text Mined References (25)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...