Property Summary

NCBI Gene PubMed Count 15
PubMed Score 1.09
PubTator Score 0.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
dermatomyositis 1.100 7.4e-04
ependymoma 1.400 1.2e-02
glioblastoma -1.400 1.9e-05
intraductal papillary-mucinous adenoma (... 1.100 2.8e-02
intraductal papillary-mucinous neoplasm ... 1.200 1.8e-02
juvenile dermatomyositis 1.063 1.4e-08
malignant mesothelioma 1.100 1.1e-03
oligodendroglioma 1.100 3.6e-02
osteosarcoma 1.531 8.3e-06
ovarian cancer -1.800 1.3e-07
Pick disease -1.800 2.2e-04
progressive supranuclear palsy -1.500 1.7e-02
tuberculosis and treatment for 6 months 1.400 2.7e-05

Gene RIF (2)

AA Sequence

MVSKMIIENFEALKSWLSKTLEPICDADPSALAKYVLALVKKDKSEKELKALCIDQLDVFLQKETQIFVE      1 - 70
KLFDAVNTKSYLPPPEQPSSGSLKVEFFPHQEKDIKKEEITKEEEREKKFSRRLNHSPPQSSSRYRENRS     71 - 140
RDERKKDDRSRKRDYDRNPPRRDSYRDRYNRRRGRSRSYSRSRSRSWSKERLRERDRDRSRTRSRSRTRS    141 - 210
RERDLVKPKYDLDRTDPLENNYTPVSSVPSISSGHYPVPTLSSTITVIAPTHHGNNTTESWSEFHEDQVD    211 - 280
HNSYVRPPMPKKRCRDYDEKGFCMRGDMCPFDHGSDPVVVEDVNLPGMLPFPAQPPVVEGPPPPGLPPPP    281 - 350
PILTPPPVNLRPPVPPPGPLPPSLPPVTGPPPPLPPLQPSGMDAPPNSATSSVPTVVTTGIHHQPPPAPP    351 - 420
SLFTADTYDTDGYNPEAPSITNTSRPMYRHRVHAQRPNLIGLTSGDMDLPPREKPPNKSSMRIVVDSESR    421 - 490
KRTIGSGEPGVPTKKTWFDKPNFNRTNSPGFQKKVQFGNENTKLELRKVPPELNNISKLNEHFSRFGTLV    491 - 560
NLQVAYNGDPEGALIQFATYEEAKKAISSTEAVLNNRFIKVYWHREGSTQQLQTTSPKVMQPLVQQPILP    561 - 630
VVKQSVKERLGPVPSSTIEPAEAQSASSDLPQNVTKLSVKDRLGFVSKPSVSATEKVLSTSTGLTKTVYN    631 - 700
PAALKAAQKTLLVSTSAVDNNEAQKKKQEALKLQQDVRKRKQEILEKHIETQKMLISKLEKNKTMKSEDK    701 - 770
AEIMKTLEVLTKNITKLKDEVKAASPGRCLPKSIKTKTQMQKELLDTELDLYKKMQAGEEVTELRRKYTE    771 - 840
LQLEAAKRGILSSGRGRGIHSRGRGAVHGRGRGRGRGRGVPGHAVVDHRPRALEISAFTESDREDLLPHF    841 - 910
AQYGEIEDCQIDDSSLHAVITFKTRAEAEAAAVHGARFKGQDLKLAWNKPVTNISAVETEEVEPDEEEFQ    911 - 980
EESLVDDSLLQDDDEEEEDNESRSWRR                                               981 - 1007
//

Text Mined References (26)

PMID Year Title