Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
urothelial carcinoma -2.000 0.001
astrocytic glioma -1.800 0.002
ependymoma -2.300 0.002
oligodendroglioma -2.100 0.006
glioblastoma -1.800 0.000
osteosarcoma 1.625 0.005
atypical teratoid / rhabdoid tumor -2.200 0.000
medulloblastoma -1.300 0.000
medulloblastoma, large-cell -2.800 0.000
primitive neuroectodermal tumor -1.500 0.000
primary pancreatic ductal adenocarcinoma 1.514 0.001
tuberculosis -1.100 0.000
diabetes mellitus -1.600 0.008
Breast cancer 1.900 0.036
adult high grade glioma -2.100 0.000
pilocytic astrocytoma -1.400 0.000
Pick disease -1.300 0.038
gastric carcinoma 1.500 0.023
ovarian cancer -2.300 0.000
pancreatic cancer 1.200 0.004

AA Sequence

MMKKKKFKFKVDFELEELSSVPFVNGVLFCKMRLLDGGSFTAESSREVVQANCVRWRKKFSFMCKMSASA      1 - 70
ATGILDPCIYRVSVRKELKGGKAYAKLGFADLNLAEFAGSGNTTRRCLLEGYDTKNTRQDNSILKVLISM     71 - 140
QLMSGDPCFKTPPSTSMSIPIAGESESLQEDRKGGETLKVHLGIADLSAKSASVPDELGACGHSRTSSYA    141 - 210
SQQSKVSGYSTCHSRSSSFSELCHRRNTSVGSTSTGVESILEPCDEIEQKIAEPNLDTADKEDTASEKLS    211 - 280
RCPVKQDSVESQLKRVDDTRVDADDIVEKILQSQDFSLDSSAEEEGLRLFVGPGGSTTFGSHHLPNRVGS    281 - 350
GAYEQVVIKR                                                                351 - 360
//

Text Mined References (10)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.