Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 3.19207329265701E-7
ovarian cancer 8492 1.02370952422236E-6
glioblastoma 5572 1.5372831927648E-6
pilocytic astrocytoma 3086 1.27212942215797E-5
adult high grade glioma 2148 1.90677183696482E-5
medulloblastoma 1524 6.44238443823495E-5
medulloblastoma, large-cell 6234 9.485192663329E-5
tuberculosis 1563 1.38534022488946E-4
primitive neuroectodermal tumor 3031 3.81991470689568E-4
primary pancreatic ductal adenocarcinoma 1271 6.29910876046273E-4
urothelial carcinoma 318 9.96507521821312E-4
ependymoma 2514 0.00169965510489416
astrocytic glioma 2241 0.00177437560741615
pancreatic cancer 2300 0.00391745547800886
osteosarcoma 7933 0.00480135224965335
oligodendroglioma 2849 0.00648699084823421
diabetes mellitus 1663 0.00832932707296907
gastric carcinoma 832 0.0226732352382575
Breast cancer 3099 0.0355700541190263
Pick disease 1893 0.037578139781248

Expression

  Differential Expression (20)

Disease log2 FC p
urothelial carcinoma -2.000 0.001
astrocytic glioma -1.800 0.002
ependymoma -2.300 0.002
oligodendroglioma -2.100 0.006
glioblastoma -1.800 0.000
osteosarcoma 1.625 0.005
atypical teratoid / rhabdoid tumor -2.200 0.000
medulloblastoma -1.300 0.000
medulloblastoma, large-cell -2.800 0.000
primitive neuroectodermal tumor -1.500 0.000
primary pancreatic ductal adenocarcinoma 1.514 0.001
tuberculosis -1.100 0.000
diabetes mellitus -1.600 0.008
Breast cancer 1.900 0.036
adult high grade glioma -2.100 0.000
pilocytic astrocytoma -1.400 0.000
Pick disease -1.300 0.038
gastric carcinoma 1.500 0.023
ovarian cancer -2.300 0.000
pancreatic cancer 1.200 0.004

Synonym

Accession Q5T8I3 A1L1A1 B0QZ46 B0QZ47 Q68DH7
Symbols SYM-3B

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA Inparanoid
C. elegans EggNOG Inparanoid

AA Sequence

MMKKKKFKFKVDFELEELSSVPFVNGVLFCKMRLLDGGSFTAESSREVVQANCVRWRKKFSFMCKMSASA      1 - 70
ATGILDPCIYRVSVRKELKGGKAYAKLGFADLNLAEFAGSGNTTRRCLLEGYDTKNTRQDNSILKVLISM     71 - 140
QLMSGDPCFKTPPSTSMSIPIAGESESLQEDRKGGETLKVHLGIADLSAKSASVPDELGACGHSRTSSYA    141 - 210
SQQSKVSGYSTCHSRSSSFSELCHRRNTSVGSTSTGVESILEPCDEIEQKIAEPNLDTADKEDTASEKLS    211 - 280
RCPVKQDSVESQLKRVDDTRVDADDIVEKILQSQDFSLDSSAEEEGLRLFVGPGGSTTFGSHHLPNRVGS    281 - 350
GAYEQVVIKR                                                                351 - 360
//

Text Mined References (10)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.