Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.51
PubTator Score 1.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.300 0.001

Gene RIF (2)

PMID Text
22082156 Knockdown of late cornified envelope-like proline-rich 1 (LELP1) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
17387579 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSSDDKSKSNDPKTEPKNCDPKCEQKCESKCQPSCLKKLLQRCFEKCPWEKCPAPPKCLPCPSQSPSSCP      1 - 70
PQPCTKPCPPKCPSSCPHACPPPCPPPE                                               71 - 98
//

Text Mined References (5)

PMID Year Title
17387579 2007 Association of a chromosome 1q21 locus in close proximity to a late cornified envelope-like proline-rich 1 (LELP1) gene with total serum IgE levels.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.