Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.51
PubTator Score 1.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1728 1.2e-03
Disease Target Count Z-score Confidence
Atopic dermatitis 952 3.372 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.300 1.2e-03

Gene RIF (4)

AA Sequence

MSSDDKSKSNDPKTEPKNCDPKCEQKCESKCQPSCLKKLLQRCFEKCPWEKCPAPPKCLPCPSQSPSSCP      1 - 70
PQPCTKPCPPKCPSSCPHACPPPCPPPE                                               71 - 98
//

Text Mined References (7)

PMID Year Title