Property Summary

NCBI Gene PubMed Count 0
PubMed Score 1.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.0e-05
Disease Target Count Z-score Confidence
Cataract 7 32 4.345 2.2

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -2.000 1.0e-05

AA Sequence

MSFSEQQCKQPCVPPPCLPKTQEQCQAKAEEVCLPTCQHPCQDKCLVQAQEVCLSQCQESSQEKCPQQGQ      1 - 70
EPYLPPCQDQCPPQCAEPCQELFQTKCVEVCPQKVQEKCSSPGKGK                             71 - 116
//

Text Mined References (1)

PMID Year Title