Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 1.01316163268488E-5

AA Sequence

MSFSEQQCKQPCVPPPCLPKTQEQCQAKAEEVCLPTCQHPCQDKCLVQAQEVCLSQCQESSQEKCPQQGQ      1 - 70
EPYLPPCQDQCPPQCAEPCQELFQTKCVEVCPQKVQEKCSSPGKGK                             71 - 116
//

Text Mined References (1)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.