Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.37
PubTator Score 3.26

Knowledge Summary

Patent (620)

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -2.500 8.6e-07
astrocytic glioma -1.500 1.0e-02
atypical teratoid / rhabdoid tumor -4.000 1.0e-06
ependymoma -3.000 1.4e-15
facioscapulohumeral dystrophy 2.100 2.3e-02
glioblastoma -2.400 3.3e-07
group 3 medulloblastoma -2.300 1.1e-04
lung carcinoma 1.200 4.7e-08
medulloblastoma, large-cell -2.900 5.7e-04
ovarian cancer 1.600 3.8e-06
Pick disease -1.900 2.5e-02
pituitary cancer -1.200 6.9e-04
primitive neuroectodermal tumor -3.600 9.0e-05
psoriasis 2.600 1.2e-46
subependymal giant cell astrocytoma -2.352 3.6e-02

Gene RIF (6)

AA Sequence

MGAMAYPLLLCLLLAQLGLGAVGASRDPQGRPDSPRERTPKGKPHAQQPGRASASDSSAPWSRSTDGTIL      1 - 70
AQKLAEEVPMDVASYLYTGDSHQLKRANCSGRYELAGLPGKWPALASAHPSLHRALDTLTHATNFLNVML     71 - 140
QSNKSREQNLQDDLDWYQALVWSLLEGEPSISRAAITFSTDSLSAPAPQVFLQATREESRILLQDLSSSA    141 - 210
PHLANATLETEWFHGLRRKWRPHLHRRGPNQGPRGLGHSWRRKDGLGGDKSHFKWSPPYLECENGSYKPG    211 - 280
WLVTLSSAIYGLQPNLVPEFRGVMKVDINLQKVDIDQCSSDGWFSGTHKCHLNNSECMPIKGLGFVLGAY    281 - 350
ECICKAGFYHPGVLPVNNFRRRGPDQHISGSTKDVSEEAYVCLPCREGCPFCADDSPCFVQEDKYLRLAI    351 - 420
ISFQALCMLLDFVSMLVVYHFRKAKSIRASGLILLETILFGSLLLYFPVVILYFEPSTFRCILLRWARLL    421 - 490
GFATVYGTVTLKLHRVLKVFLSRTAQRIPYMTGGRVMRMLAVILLVVFWFLIGWTSSVCQNLEKQISLIG    491 - 560
QGKTSDHLIFNMCLIDRWDYMTAVAEFLFLLWGVYLCYAVRTVPSAFHEPRYMAVAVHNELIISAIFHTI    561 - 630
RFVLASRLQSDWMLMLYFAHTHLTVTVTIGLLLIPKFSHSSNNPRDDIATEAYEDELDMGRSGSYLNSSI    631 - 700
NSAWSEHSLDPEDIRDELKKLYAQLEIYKRKKMITNNPHLQKKRCSKKGLGRSIMRRITEIPETVSRQCS    701 - 770
KEDKEGADHGTAKGTALIRKNPPESSGNTGKSKEETLKNRVFSLKKSHSTYDHVRDQTEESSSLPTESQE    771 - 840
EETTENSTLESLSGKKLTQKLKEDSEAESTESVPLVCKSASAHNLSSEKKTGHPRTSMLQKSLSVIASAK    841 - 910
EKTLGLAGKTQTAGVEERTKSQKPLPKDKETNRNHSNSDNTETKDPAPQNSNPAEEPRKPQKSGIMKQQR    911 - 980
VNPTTANSDLNPGTTQMKDNFDIGEVCPWEVYDLTPGPVPSESKVQKHVSIVASEMEKNPTFSLKEKSHH    981 - 1050
KPKAAEVCQQSNQKRIDKAEVCLWESQGQSILEDEKLLISKTPVLPERAKEENGGQPRAANVCAGQSEEL   1051 - 1120
PPKAVASKTENENLNQIGHQEKKTSSSEENVRGSYNSSNNFQQPLTSRAEVCPWEFETPAQPNAGRSVAL   1121 - 1190
PASSALSANKIAGPRKEEIWDSFKV                                                1191 - 1215
//

Text Mined References (16)

PMID Year Title