Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.13
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adrenocortical carcinoma 1.130 1.7e-03
Alzheimer's disease 1.100 1.6e-02
atypical teratoid / rhabdoid tumor 2.000 4.7e-06
ependymoma 1.400 1.6e-07
glioblastoma 1.400 2.9e-03
group 3 medulloblastoma 2.700 3.9e-06
lung carcinoma 1.400 1.8e-20
medulloblastoma, large-cell 1.500 2.8e-03
osteosarcoma -1.191 5.1e-03
ovarian cancer 1.100 2.1e-03
pancreatic ductal adenocarcinoma liver m... 1.026 7.2e-03
Pick disease 1.200 4.3e-04
primitive neuroectodermal tumor 2.000 2.9e-03

Gene RIF (5)

AA Sequence

MNQPGGAAAPQADGASAAGRKSTASRERLKRSQKSTKVEGPEPVPAEASLSAEQGTMTEVKVKTELPDDY      1 - 70
IQEVIWQGEAKEEKKAVSKDGTSDVPAEICVVIGGVRNQQTLDGKAPEGSPHGGSVRSRYSGTWIFDQAL     71 - 140
RYASGSYECGICGKKYKYYNCFQTHVRAHRDTEATSGEGASQSNNFRYTCDICGKKYKYYSCFQEHRDLH    141 - 210
AVDVFSVEGAPENRADPFDQGVVATDEVKEEPPEPFQKIGPKTGNYTCEFCGKQYKYYTPYQEHVALHAP    211 - 280
ISTAPGWEPPDDPDTGSECSHPEVSPSPRFVAAKTQTNQSGKKAPASVVRCATLLHRTPPATQTQTFRTP    281 - 350
NSGSPASKATAAESAFSRRVEGKAQNHFEETNSSSQNSSEPYTCGACGIQFQFYNNLLEHMQSHAADNEN    351 - 420
NIASNQSRSPPAVVEEKWKPQAQRNSANNTTTSGLTPNSMIPEKERQNIAERLLRVMCADLGALSVVSGK    421 - 490
EFLKLAQTLVDSGARYGAFSVTEILGNFNTLALKHLPRMYNQVKVKVTCALGSNACLGIGVTCHSQSVGP    491 - 560
DSCYILTAYQAEGNHIKSYVLGVKGADIRDSGDLVHHWVQNVLSEFVMSEIRTVYVTDCRVSTSAFSKAG    561 - 630
MCLRCSACALNSVVQSVLSKRTLQARSMHEVIELLNVCEDLAGSTGLAKETFGSLEETSPPPCWNSVTDS    631 - 700
LLLVHERYEQICEFYSRAKKMNLIQSLNKHLLSNLAAILTPVKQAVIELSNESQPTLQLVLPTYVRLEKL    701 - 770
FTAKANDAGTVSKLCHLFLEALKENFKVHPAHKVAMILDPQQKLRPVPPYQHEEIIGKVCELINEVKESW    771 - 840
AEEADFEPAAKKPRSAAVENPAAQEDDRLGKNEVYDYLQEPLFQATPDLFQYWSCVTQKHTKLAKLAFWL    841 - 910
LAVPAVGARSGCVNMCEQALLIKRRRLLSPEDMNKLMFLKSNML                              911 - 954
//

Text Mined References (16)

PMID Year Title