Property Summary

NCBI Gene PubMed Count 16
PubMed Score 25.63
PubTator Score 9.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytoma 1.200 0.000
glioblastoma 1.300 0.000
oligodendroglioma 1.200 0.000
ependymoma 1.100 0.000
primitive neuroectodermal tumor 1.200 0.001
juvenile dermatomyositis 1.279 0.000
intraductal papillary-mucinous adenoma (... 1.300 0.006
pediatric high grade glioma 1.300 0.000
pilocytic astrocytoma 1.300 0.000
nasopharyngeal carcinoma 1.200 0.000
ovarian cancer 1.200 0.003

Synonym

Accession Q5T7V8 Q49A22 Q6P1P9 Q9HAE6 Q9Y350
Symbols GO
NTKLBP1
SCYL1BP1

Gene

Gene RIF (9)

PMID Text
25980818 SCYL1- BP1 affects the cell cycle through increasing steady state levels of Cyclin F and RRM2 proteins, thus constituting a dual regulatory circuit
25819896 rs17684886 (ZNRF1) and rs599019 (COLEC12) are associated with diabetic retinopathy and rs6427247 (SCYL1BP1) and rs899036 (API5) are associated with severe diabetic retinopathy in Chinese patients with type 2 diabetes
25234469 SCYL1-BP1 plays a critical role in the regulation of EEA1, BMPR2 and BRCA2 expression.
25227860 SCYL1BP1 can promote the degradation of MDM2 protein and further inhibit the G1/S transition of lung SCC lines. Reintroduction of SCYL1BP1 into lung SCC lines significantly inhibited cell proliferation, migration, invasion and tumor formation.
20849854 Data suggest that SCYL1-BP1 is a novel regulator of the MDM2-p53 feedback loop and that it may be a potential tumor suppressor.
19951712 The chemotaxis signal pathway induced by chemokines CKbeta8 and CKbeta8-1 is mediated via the Gi/Go protein, phospholipase C (PLC) and protein kinase C delta (PKC delta).
19681135 study supplements the limited available data on SCYL1BP1 and further establishes deficiency of this recently described golgin as the only known cause of geroderma osteodysplastica
18997784 Study demonstrates that gerodermia osteodysplastica is caused by loss-of-function mutations in SCYL1BP1, which is highly expressed in skin and osteoblasts.
15781263 assessment of interaction with hPirh2

AA Sequence

MSWAAVLAVAAARFGHFWGCRWPGPMAQGWAGFSEEELRRLKQTKDPFEPQRRLPAKKSRQQLQREKALV      1 - 70
EQSQKLGLQDGSTSLLPEQLLSAPKQRVNVQKPPFSSPTLPSHFTLTSPVGDGQPQGIESQPKELGLENS     71 - 140
HDGHNNVEILPPKPDCKLEKKKVELQEKSRWEVLQQEQRLMEEKNKRKKALLAKAIAERSKRTQAETMKL    141 - 210
KRIQKELQALDDMVSADIGILRNRIDQASLDYSYARKRFDRAEAEYIAAKLDIQRKTEIKEQLTEHLCTI    211 - 280
IQQNELRKAKKLEELMQQLDVEADEETLELEVEVERLLHEQEVESRRPVVRLERPFQPAEESVTLEFAKE    281 - 350
NRKCQEQAVSPKVDDQCGNSSSIPFLSPNCPNQEGNDISAALAT                              351 - 394
//

Text Mined References (17)

PMID Year Title
25980818 2016 SCYL1-BP1 affects cell cycle arrest in human hepatocellular carcinoma cells via Cyclin F and RRM2.
25819896 2015 Common variants in or near ZNRF1, COLEC12, SCYL1BP1 and API5 are associated with diabetic retinopathy in Chinese patients with type 2 diabetes.
25234469 2014 Transcriptional profiling and dynamical regulation analysis identify potential kernel target genes of SCYL1-BP1 in HEK293T cells.
25227860 2014 SCYL1BP1 has tumor-suppressive functions in human lung squamous carcinoma cells by regulating degradation of MDM2.
20849854 2010 Overexpression of SCYL1-BP1 stabilizes functional p53 by suppressing MDM2-mediated ubiquitination.
20598683 2010 A newly identified Pirh2 substrate SCYL1-BP1 can bind to MDM2 and accelerate MDM2 self-ubiquitination.
19951712 2010 CK beta 8/CCL23 induces cell migration via the Gi/Go protein/PLC/PKC delta/NF-kappa B and is involved in inflammatory responses.
19681135 2009 A novel missense mutation in SCYL1BP1 produces geroderma osteodysplastica phenotype indistinguishable from that caused by nullimorphic mutations.
18997784 2008 Gerodermia osteodysplastica is caused by mutations in SCYL1BP1, a Rab-6 interacting golgin.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...