Property Summary

NCBI Gene PubMed Count 17
PubMed Score 28.09
PubTator Score 9.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytoma 1.200 1.4e-18
Astrocytoma, Pilocytic 1.300 6.2e-05
ependymoma 1.100 1.2e-04
glioblastoma 1.300 1.7e-06
intraductal papillary-mucinous adenoma (... 1.300 6.0e-03
juvenile dermatomyositis 1.279 2.2e-10
nasopharyngeal carcinoma 1.200 3.4e-06
oligodendroglioma 1.200 1.1e-13
ovarian cancer 1.200 3.0e-03
pediatric high grade glioma 1.300 6.3e-05
primitive neuroectodermal tumor 1.200 7.7e-04

Gene RIF (10)

AA Sequence

MSWAAVLAVAAARFGHFWGCRWPGPMAQGWAGFSEEELRRLKQTKDPFEPQRRLPAKKSRQQLQREKALV      1 - 70
EQSQKLGLQDGSTSLLPEQLLSAPKQRVNVQKPPFSSPTLPSHFTLTSPVGDGQPQGIESQPKELGLENS     71 - 140
HDGHNNVEILPPKPDCKLEKKKVELQEKSRWEVLQQEQRLMEEKNKRKKALLAKAIAERSKRTQAETMKL    141 - 210
KRIQKELQALDDMVSADIGILRNRIDQASLDYSYARKRFDRAEAEYIAAKLDIQRKTEIKEQLTEHLCTI    211 - 280
IQQNELRKAKKLEELMQQLDVEADEETLELEVEVERLLHEQEVESRRPVVRLERPFQPAEESVTLEFAKE    281 - 350
NRKCQEQAVSPKVDDQCGNSSSIPFLSPNCPNQEGNDISAALAT                              351 - 394
//

Text Mined References (18)

PMID Year Title