Property Summary

NCBI Gene PubMed Count 16
PubMed Score 8.14
PubTator Score 7.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma 1.300 0.007
osteosarcoma 1.123 0.001
group 4 medulloblastoma 2.200 0.001
psoriasis -1.100 0.000

Synonym

Accession Q5T7P8 B1AMB8 B3KPK1
Symbols sytVI

Gene

Gene RIF (3)

PMID Text
20551332 synaptotagmin must be dephosphorylated at a specific window of time and phosphorylated synaptotagmin has an active role at early stages of the acrosomal exocytosis.
18639284 SYT6 is hypermethylated in renal cell carcinoma.
16111671 Acrosomal exocytosis is regulated through the PKC-mediated phosphorylation of conserved threonines in the polybasic regions of synaptotagmin VI.

AA Sequence

MSGVWGAGGPRCQEALAVLASLCRARPPPLGLDVETCRSFELQPPERSPSAAGAGTSVSLLAVVVIVCGV      1 - 70
ALVAVFLFLFWKLCWMPWRNKEASSPSSANPPLEALQSPSFRGNMADKLKDPSTLGFLEAAVKISHTSPD     71 - 140
IPAEVQMSVKEHIMRHTRLQRQTTEPASSTRHTSFKRHLPRQMHVSSVDYGNELPPAAEQPTSIGRIKPE    141 - 210
LYKQKSVDGEDAKSEATKSCGKINFSLRYDYETETLIVRILKAFDLPAKDFCGSSDPYVKIYLLPDRKCK    211 - 280
LQTRVHRKTLNPTFDENFHFPVPYEELADRKLHLSVFDFDRFSRHDMIGEVILDNLFEASDLSRETSIWK    281 - 350
DIQYATSESVDLGEIMFSLCYLPTAGRLTLTVIKCRNLKAMDITGYSDPYVKVSLLCDGRRLKKKKTTIK    351 - 420
KNTLNPVYNEAIIFDIPPENMDQVSLLISVMDYDRVGHNEIIGVCRVGITAEGLGRDHWNEMLAYPRKPI    421 - 490
AHWHSLVEVKKSFKEGNPRL                                                      491 - 510
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23942779 2013 A genome-wide association study of behavioral disinhibition.
23319801 2013 Identification of inherited genetic variations influencing prognosis in early-onset breast cancer.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20551332 2010 Calcineurin-mediated dephosphorylation of synaptotagmin VI is necessary for acrosomal exocytosis.
18639284 2008 Identification of novel epigenetic markers for clear cell renal cell carcinoma.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...