Property Summary

NCBI Gene PubMed Count 16
PubMed Score 8.19
PubTator Score 7.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 2.9e-09
group 4 medulloblastoma 1855 8.1e-04
osteosarcoma 7950 1.4e-03
astrocytic glioma 2597 6.7e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Cognitive disorder 50 0.0 1.2

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma 1.300 6.7e-03
group 4 medulloblastoma 2.200 8.1e-04
osteosarcoma 1.123 1.4e-03
psoriasis -1.100 2.9e-09

Gene RIF (3)

AA Sequence

MSGVWGAGGPRCQEALAVLASLCRARPPPLGLDVETCRSFELQPPERSPSAAGAGTSVSLLAVVVIVCGV      1 - 70
ALVAVFLFLFWKLCWMPWRNKEASSPSSANPPLEALQSPSFRGNMADKLKDPSTLGFLEAAVKISHTSPD     71 - 140
IPAEVQMSVKEHIMRHTRLQRQTTEPASSTRHTSFKRHLPRQMHVSSVDYGNELPPAAEQPTSIGRIKPE    141 - 210
LYKQKSVDGEDAKSEATKSCGKINFSLRYDYETETLIVRILKAFDLPAKDFCGSSDPYVKIYLLPDRKCK    211 - 280
LQTRVHRKTLNPTFDENFHFPVPYEELADRKLHLSVFDFDRFSRHDMIGEVILDNLFEASDLSRETSIWK    281 - 350
DIQYATSESVDLGEIMFSLCYLPTAGRLTLTVIKCRNLKAMDITGYSDPYVKVSLLCDGRRLKKKKTTIK    351 - 420
KNTLNPVYNEAIIFDIPPENMDQVSLLISVMDYDRVGHNEIIGVCRVGITAEGLGRDHWNEMLAYPRKPI    421 - 490
AHWHSLVEVKKSFKEGNPRL                                                      491 - 510
//

Text Mined References (17)

PMID Year Title