Property Summary

NCBI Gene PubMed Count 5
PubMed Score 11.68
PubTator Score 4.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Atopic dermatitis 952 6.8e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (1)

Disease log2 FC p
Atopic dermatitis -3.100 6.8e-05

Gene RIF (1)

AA Sequence

MSCQQNQQQCQPPPKCIPKCPPKCLTPRCPPKCPPKCPPVSSCCSVSSGGCCGSSSGGSCGSSSGGCCSS      1 - 70
GGGGCCLSHHRRRRSHCHRPQSSGCCSQPSGGSSCCGGGSGQHSGGCC                           71 - 118
//

Text Mined References (6)

PMID Year Title