Property Summary

NCBI Gene PubMed Count 3
PubMed Score 14.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
breast carcinoma 1638 1.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (1)

Disease log2 FC p
breast carcinoma 1.400 1.7e-02

Gene RIF (1)

AA Sequence

MSCQQSQQQCQPPPKCTPKCPPKCPTPKCPPKCPPKCPPVSSCCSVSSGGCCGSSSGGGCSSGGGGCCLS      1 - 70
HHRRHRSHRHRLQSSGCCSQPSGGSSCCGGDSGQHSGGCC                                   71 - 110
//

Text Mined References (3)

PMID Year Title