Property Summary

NCBI Gene PubMed Count 3
PubMed Score 12.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
breast carcinoma 1,614

Expression

  Differential Expression (1)

Disease log2 FC p
breast carcinoma 1.400 0.017

Gene RIF (1)

PMID Text
15854049 a paper relating nomenclature changes and expression in range of tissues and in response to UV

AA Sequence

MSCQQSQQQCQPPPKCTPKCPPKCPTPKCPPKCPPKCPPVSSCCSVSSGGCCGSSSGGGCSSGGGGCCLS      1 - 70
HHRRHRSHRHRLQSSGCCSQPSGGSSCCGGDSGQHSGGCC                                   71 - 110
//

Text Mined References (3)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15854049 2005 Late cornified envelope family in differentiating epithelia--response to calcium and ultraviolet irradiation.
11698679 2001 Differentially expressed late constituents of the epidermal cornified envelope.