Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.00
PubTator Score 1.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 3.34448196852658E-52
non-small cell lung cancer 2798 4.72151291610384E-9
intraductal papillary-mucinous carcinoma (IPMC) 2988 2.53542942925923E-5
posterior fossa group B ependymoma 1530 1.05961915038341E-4
breast carcinoma 1614 1.16487314444744E-4
primary pancreatic ductal adenocarcinoma 1271 4.85334954160665E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 7.20067938225022E-4
Atopic dermatitis 944 0.00407599654947812
active Crohn's disease 918 0.00417130170230557
pancreatic cancer 2300 0.00444005437240045
invasive ductal carcinoma 2950 0.00635609290890401
active ulcerative colitis 477 0.00637606559067656
ovarian cancer 8492 0.00889945475030112
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0237651766624305
pediatric high grade glioma 2712 0.0288016823868078
fibroadenoma 557 0.0392763818743188

Expression

Synonym

Accession Q5T7N3 B1ALP7 Q6P9A0 Q86T71 Q86VE6 Q8NAX3
Symbols ANKRD38
dJ1078M7.1

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
25961457 identified recessive mutations in kidney ankyrin repeat-containing protein 1 (KANK1), KANK2, and KANK4 in individuals with nephrotic syndrome.

AA Sequence

MEKTDAKDQSSQGDEEKDPPKSHPYSVETPYGFHLDLDFLKYVDDIEKGNTIKRIPIHRRAKQAKFSTLP      1 - 70
RNFSLPDSGARPPAAPPLQNWSPVVPREASLGTQEQNQSPPLGNAPQASTSRSEVSYHRKALLAEATRQL     71 - 140
EAAEPEDAELTFGSGRPQLLRASSMPATLLHSRASEEPGLSLGPPAPPALPPLQGEGSVCDGTFEPAEGL    141 - 210
AGFHSSSPRASTRIPELVQEGAEPPEGVVKVPNHLPLPGPPFSFQNVLVVLEDKEDEHNAREAEVLFTPG    211 - 280
SPTPSPPPLPSPIPENELLLEEIELNISEIPPPPPVEVDMRSIGIRVTEESLGLARVDPGSISSLKQQVS    281 - 350
ALEGELSGRTEELAQVRTALQQQEEEIKAREQRIRELEFTVAQLEGQFHQENAKDTQGQTDVMVNTDPVH    351 - 420
GLLTRESCDKGIEVNLLGSMESESWGHRGEENGLLWGPDGHKQGNQSPAERVLLPQLSLPQGPEQVLTSS    421 - 490
VHSFLSTELRIEEAGTEQEGGPQGGTRGAGGFLWGSDRKTPPAGREETSSNLPGKEHPGRPPSSPTDATI    491 - 560
GQYVKKIQELLQEQWNCLEHGYPELASAIKQPASKLSSIQSQLLSSLNLLLSAYSAQAHPPKEPPASSSS    561 - 630
PPVEISPSTSLKSIMKKKDYGFRAGGNGTKKNLQFVGVNGGYETTSSEETSGEDSTPEDLSDSEAEKKCD    631 - 700
GPDHKHVKDAHLTCEAGQGIPEGTCHAAQESGPGEEVPHSKAERYKPSEEFLNACRALSQHLPETGTTTD    701 - 770
QLLRQSLNTISQEWFRVSSRKSSSPAVVASYLHEVQPHSPHFLKLLVNLADHNGNTALHYSVSHSNFSIV    771 - 840
KLLLETGVCNVDHQNKAGYTAVMITPLASAETNEDMAVVWKLLREGNVNIQATQGGQTALMLGVSHDRED    841 - 910
MVQALLSCQADVNLQDHDGSSALMVACHHGNVDLVRLLLAHPACDSSLTDKAGRTALSIALKSPTHMEIA    911 - 980
GLLRAHAEQGRSLGL                                                           981 - 995
//

Text Mined References (8)

PMID Year Title
25961457 2015 KANK deficiency leads to podocyte dysfunction and nephrotic syndrome.
19554261 2009 Kank proteins: structure, functions and diseases.
17996375 2008 Kank proteins: a new family of ankyrin-repeat domain-containing proteins.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.