Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.63
PubTator Score 1.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
active Crohn's disease -1.896 4.2e-03
active ulcerative colitis -2.667 6.4e-03
Atopic dermatitis -1.200 4.1e-03
breast carcinoma -1.800 1.2e-04
ependymoma -1.400 9.7e-05
fibroadenoma -1.500 3.9e-02
intraductal papillary-mucinous adenoma (... -2.200 2.4e-02
intraductal papillary-mucinous carcinoma... -3.900 2.5e-05
intraductal papillary-mucinous neoplasm ... -3.700 7.2e-04
invasive ductal carcinoma 1.002 1.2e-02
non-small cell lung cancer -1.089 4.7e-09
ovarian cancer -1.100 8.9e-03
pancreatic cancer -1.400 4.4e-03
pediatric high grade glioma -1.200 2.9e-02
primary pancreatic ductal adenocarcinoma -1.737 4.9e-04
psoriasis -1.900 3.3e-52

Gene RIF (1)

AA Sequence

MEKTDAKDQSSQGDEEKDPPKSHPYSVETPYGFHLDLDFLKYVDDIEKGNTIKRIPIHRRAKQAKFSTLP      1 - 70
RNFSLPDSGARPPAAPPLQNWSPVVPREASLGTQEQNQSPPLGNAPQASTSRSEVSYHRKALLAEATRQL     71 - 140
EAAEPEDAELTFGSGRPQLLRASSMPATLLHSRASEEPGLSLGPPAPPALPPLQGEGSVCDGTFEPAEGL    141 - 210
AGFHSSSPRASTRIPELVQEGAEPPEGVVKVPNHLPLPGPPFSFQNVLVVLEDKEDEHNAREAEVLFTPG    211 - 280
SPTPSPPPLPSPIPENELLLEEIELNISEIPPPPPVEVDMRSIGIRVTEESLGLARVDPGSISSLKQQVS    281 - 350
ALEGELSGRTEELAQVRTALQQQEEEIKAREQRIRELEFTVAQLEGQFHQENAKDTQGQTDVMVNTDPVH    351 - 420
GLLTRESCDKGIEVNLLGSMESESWGHRGEENGLLWGPDGHKQGNQSPAERVLLPQLSLPQGPEQVLTSS    421 - 490
VHSFLSTELRIEEAGTEQEGGPQGGTRGAGGFLWGSDRKTPPAGREETSSNLPGKEHPGRPPSSPTDATI    491 - 560
GQYVKKIQELLQEQWNCLEHGYPELASAIKQPASKLSSIQSQLLSSLNLLLSAYSAQAHPPKEPPASSSS    561 - 630
PPVEISPSTSLKSIMKKKDYGFRAGGNGTKKNLQFVGVNGGYETTSSEETSGEDSTPEDLSDSEAEKKCD    631 - 700
GPDHKHVKDAHLTCEAGQGIPEGTCHAAQESGPGEEVPHSKAERYKPSEEFLNACRALSQHLPETGTTTD    701 - 770
QLLRQSLNTISQEWFRVSSRKSSSPAVVASYLHEVQPHSPHFLKLLVNLADHNGNTALHYSVSHSNFSIV    771 - 840
KLLLETGVCNVDHQNKAGYTAVMITPLASAETNEDMAVVWKLLREGNVNIQATQGGQTALMLGVSHDRED    841 - 910
MVQALLSCQADVNLQDHDGSSALMVACHHGNVDLVRLLLAHPACDSSLTDKAGRTALSIALKSPTHMEIA    911 - 980
GLLRAHAEQGRSLGL                                                           981 - 995
//

Text Mined References (8)

PMID Year Title