Property Summary

NCBI Gene PubMed Count 14
Grant Count 3
Funding $241,460
PubMed Score 4.99
PubTator Score 1.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
active Crohn's disease 1.904 0.024
ulcerative colitis 1.400 0.011

Gene RIF (10)

PMID Text
26159230 L1TD1 depletion reduced medulloblastoma cell viability, cell proliferation, downregulated expression of the neural stem cell markers and induced apoptosis.
25702638 we show that L1TD1 is a part of the pluripotency interactome network of OCT4, SOX2, and NANOG, bridging nuclear and cytoplasmic regulation and highlighting the importance of RNA biology in pluripotency.
25211013 L1TD1 may have become incorporated into pluripotency maintenance in some lineages.
24769218 LINE-1 methylation was evaluated, a statistical difference was seen amongst groups and a slight hypomethylated state in the AgP samples was observed.
23415968 Paternal methylation aberrations at imprinting control regions of DLK1-GTL2, MEST (PEG1), and ZAC (PLAGL1) and global methylation levels are not associated with idiopathic recurrent spontaneous miscarriages.
23179365 LINE-1 hypomethylation in gastric cancer is associated with shorter survival, suggesting that it has potential for use as a prognostic biomarker.
22162396 L1TD1 is part of the L1TD1-RHA-LIN28 complex that could influence levels of OCT4, suggesting that L1TD1 has an important role in the regulation of stemness.
21559406 L1TD1 is a downstream target of Nanog and represents a useful marker for identifying undifferentiated hESC
21445976 there was no significant association of LINE-1 methylation with case status, although reduced LINE-1 methylation was associated with increased risk of bladder cancer among never smokers
18842996 LINE-1 hypomethylation is significantly associated with CpG island hypermethylation in EF+ gastritis.

AA Sequence

MSDVSTSVQSKFARLAKKKENITYMKREQLTETDKDIAPVLDLKCKDVSAIMNKFKVLMEIQDLMFEEMR      1 - 70
ETLKNDLKAVLGGKATIPEVKNSENSSSRTEFQQIINLALQKTGMVGKIEGENSKIGDDNENLTFKLEVN     71 - 140
ELSGKLDNTNEYNSNDGKKLPQGESRSYEVMGSMEETLCNIDDRDGNRNVHLEFTERESRKDGEDEFVKE    141 - 210
MREERKFQKLKNKEEVLKASREEKVLMDEGAVLTLVADLSSATLDISKQWSNVFNILRENDFEPKFLCEV    211 - 280
KLAFKCDGEIKTFSDLQSLRKFASQKSSVKELLKDVLPQKEEINQGGRKYGIQEKRDKTLIDSKHRAGEI    281 - 350
TSDGLSFLFLKEVKVAKPEEMKNLETQEEEFSELEELDEEASGMEDDEDTSGLEEEEEEPSGLEEEEEEE    351 - 420
ASGLEEDEASGLEEEEEQTSEQDSTFQGHTLVDAKHEVEITSDGMETTFIDSVEDSESEEEEEGKSSETG    421 - 490
KVKTTSLTEKKASRRQKEIPFSYLVGDSGKKKLVKHQVVHKTQEEEETAVPTSQGTGTPCLTLCLASPSK    491 - 560
SLEMSHDEHKKHSHTNLSISTGVTKLKKTEEKKHRTLHTEELTSKEADLTEETEENLRSSVINSIREIKE    561 - 630
EIGNLKSSHSGVLEIENSVDDLSSRMDILEERIDSLEDQIEEFSKDTMQMTKQIISKERQRDIEERSRSC    631 - 700
NIRLIGIPEKESYENRAEDIIKEIIDENFAELKKGSSLEIVSACRVPSKIDEKRLTPRHILVKFWNSSDK    701 - 770
EKIIRASRERREITYQGTRIRLTADLSLDTLDARSKWSNVFKVLLEKGFNPRILYPAKMAFDFRGKTKVF    771 - 840
LSIEEFRDYVLHMPTLRELLGNNIP                                                 841 - 865
//

Text Mined References (18)

PMID Year Title
26159230 2015 Embryonic Stem Cell-Related Protein L1TD1 Is Required for Cell Viability, Neurosphere Formation, and Chemoresistance in Medulloblastoma.
25702638 2015 The L1TD1 protein interactome reveals the importance of post-transcriptional regulation in human pluripotency.
25211013 2014 Positive selection and multiple losses of the LINE-1-derived L1TD1 gene in mammals suggest a dual role in genome defense and pluripotency.
24769218 2014 DNA methylation levels of SOCS1 and LINE-1 in oral epithelial cells from aggressive periodontitis patients.
23415968 2013 Methylation status of imprinted genes DLK1-GTL2, MEST (PEG1), ZAC (PLAGL1), and LINE-1 elements in spermatozoa of normozoospermic men, unlike H19 imprinting control regions, is not associated with idiopathic recurrent spontaneous miscarriages.
23179365 2013 LINE-1 hypomethylation in gastric cancer, detected by bisulfite pyrosequencing, is associated with poor prognosis.
22162396 2012 RNA-binding protein L1TD1 interacts with LIN28 via RNA and is required for human embryonic stem cell self-renewal and cancer cell proliferation.
21559406 2011 L1TD1 is a marker for undifferentiated human embryonic stem cells.
21445976 2012 LINE-1 hypomethylation is associated with bladder cancer risk among nonsmoking Chinese.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...