Property Summary

NCBI Gene PubMed Count 6
PubMed Score 9.54
PubTator Score 5.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Obesity 616 3.099 1.5

Expression

Gene RIF (5)

PMID Text
24612181 Serum adipolin concentrations were significantly lower in polycystic ovarian syndrome compared with control subjects.
24492466 In subcutaneous adipose tissue explants, insulin significantly increased CTRP12 protein expression and secretion.
22942287 Endopeptidase cleavage generates a functionally distinct isoform of C1q/tumor necrosis factor-related protein-12 (CTRP12) with an altered oligomeric state and signaling specificity.
22736092 we describe, for the first time, adipolin expression in human chondrocytes as well as the intracellular mechanism involved in its regulation
21849507 Reports cloning, expression, regulation and function of mouse adipolin (Fam132a)

AA Sequence

MRRWAWAAVVVLLGPQLVLLGGVGARREAQRTQQPGQRADPPNATASASSREGLPEAPKPSQASGPEFSD      1 - 70
AHMTWLNFVRRPDDGALRKRCGSRDKKPRDLFGPPGPPGAEVTAETLLHEFQELLKEATERRFSGLLDPL     71 - 140
LPQGAGLRLVGEAFHCRLQGPRRVDKRTLVELHGFQAPAAQGAFLRGSGLSLASGRFTAPVSGIFQFSAS    141 - 210
LHVDHSELQGKARLRARDVVCVLICIESLCQRHTCLEAVSGLESNSRVFTLQVQGLLQLQAGQYASVFVD    211 - 280
NGSGAVLTIQAGSSFSGLLLGT                                                    281 - 302
//

Text Mined References (9)

PMID Year Title
24612181 2014 Circulatory changes of the novel adipokine adipolin/CTRP12 in response to metformin treatment and an oral glucose challenge in humans.
24492466 2014 Insulin regulates the novel adipokine adipolin/CTRP12: in vivo and ex vivo effects.
22942287 2012 Endopeptidase cleavage generates a functionally distinct isoform of C1q/tumor necrosis factor-related protein-12 (CTRP12) with an altered oligomeric state and signaling specificity.
22736092 2013 Expression and modulation of adipolin/C1qdc2: a novel adipokine in human and murine ATDC-5 chondrocyte cell line.
22275362 2012 C1q/TNF-related protein-12 (CTRP12), a novel adipokine that improves insulin sensitivity and glycemic control in mouse models of obesity and diabetes.
21849507 2011 Adipolin/C1qdc2/CTRP12 protein functions as an adipokine that improves glucose metabolism.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.