Property Summary

NCBI Gene PubMed Count 8
PubMed Score 9.69
PubTator Score 5.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Obesity 678 3.068 1.5

Expression

Gene RIF (7)

AA Sequence

MRRWAWAAVVVLLGPQLVLLGGVGARREAQRTQQPGQRADPPNATASASSREGLPEAPKPSQASGPEFSD      1 - 70
AHMTWLNFVRRPDDGALRKRCGSRDKKPRDLFGPPGPPGAEVTAETLLHEFQELLKEATERRFSGLLDPL     71 - 140
LPQGAGLRLVGEAFHCRLQGPRRVDKRTLVELHGFQAPAAQGAFLRGSGLSLASGRFTAPVSGIFQFSAS    141 - 210
LHVDHSELQGKARLRARDVVCVLICIESLCQRHTCLEAVSGLESNSRVFTLQVQGLLQLQAGQYASVFVD    211 - 280
NGSGAVLTIQAGSSFSGLLLGT                                                    281 - 302
//

Text Mined References (11)

PMID Year Title