Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

Gene RIF (1)

AA Sequence

MSCQQSQQQCQPPPKCTPKCPPKCPTPKCPPKCPPKCPPVSSCCSVSSGGCCGSSSGGCCSSGGGGCCSS      1 - 70
GGGGCCLSHHRRRRSHRHRPQSSDCCSQPSAGSSCCGGGSGQHSGGCC                           71 - 118
//

Text Mined References (4)

PMID Year Title