Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma 1.400 2.5e-04
atypical teratoid/rhabdoid tumor 1.100 2.9e-03
diabetes mellitus 1.600 2.6e-03
medulloblastoma, large-cell 1.600 3.6e-05
osteosarcoma 2.253 2.2e-10
ovarian cancer 1.700 9.1e-14

Gene RIF (1)

AA Sequence

MSCQQSQQQCQPPPKCTPKCPPKCPTPKCPPKCPPKCPPVSSCCSVSSGGCCGSSSGGSCGSSSGGCCSS      1 - 70
GGGGCCLSHHRHHRSHRHRPQSSDCCSQPSGGSSCCGGGSGQHSGGCC                           71 - 118
//

Text Mined References (4)

PMID Year Title