Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Inflammatory dermatosis 38
Disease Target Count P-value
ovarian cancer 8492 9.13558630730897E-14
osteosarcoma 7933 2.16693052541962E-10
medulloblastoma, large-cell 6234 3.56192638922029E-5
adult high grade glioma 2148 2.50822677586607E-4
diabetes mellitus 1663 0.00258632267291173
atypical teratoid/rhabdoid tumor 1095 0.0029167590124063

Gene RIF (1)

PMID Text
15854049 paper describing nomenclature changes and expression in range of tissues and in response to UV

AA Sequence

MSCQQSQQQCQPPPKCTPKCPPKCPTPKCPPKCPPKCPPVSSCCSVSSGGCCGSSSGGSCGSSSGGCCSS      1 - 70
GGGGCCLSHHRHHRSHRHRPQSSDCCSQPSGGSSCCGGGSGQHSGGCC                           71 - 118
//

Text Mined References (4)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15854049 2005 Late cornified envelope family in differentiating epithelia--response to calcium and ultraviolet irradiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11698679 2001 Differentially expressed late constituents of the epidermal cornified envelope.