Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.29
PubTator Score 0.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung adenocarcinoma 2716 3.0e-06

Gene RIF (1)

AA Sequence

MSCQQSQQQCQPPPKCTPKCTPKCPAPKCPPKCPPVSSCCSVSSGGCCGSSSGGGCGSNSGGCCSSGGGG      1 - 70
CCLSHHRRHRSHRRRPQSSDCCSQPSGGSSCCGGGSSQHSGGCC                               71 - 114
//

Text Mined References (5)

PMID Year Title