Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.29
PubTator Score 0.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
lung adenocarcinoma 2,713

Gene RIF (1)

PMID Text
15854049 paper describing nomenclature changes and expression in range of tissues and in response to UV

AA Sequence

MSCQQSQQQCQPPPKCTPKCTPKCPAPKCPPKCPPVSSCCSVSSGGCCGSSSGGGCGSNSGGCCSSGGGG      1 - 70
CCLSHHRRHRSHRRRPQSSDCCSQPSGGSSCCGGGSSQHSGGCC                               71 - 114
//

Text Mined References (5)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
23227193 2012 Analysis of copy number variation in Alzheimer's disease in a cohort of clinically characterized and neuropathologically verified individuals.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15854049 2005 Late cornified envelope family in differentiating epithelia--response to calcium and ultraviolet irradiation.
11698679 2001 Differentially expressed late constituents of the epidermal cornified envelope.