Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.25
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Atopic dermatitis 944
psoriasis 6,685

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -1.400 0.018
Atopic dermatitis -3.100 0.000

Gene RIF (2)

PMID Text
25197941 SNPs in C1orf68 are associated with increased risk of candidemia.
20200978 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MCDQQKQPQFPPSCVKGSGLGAGQGSNGASVKCPVPCQTQTVCVTGPAPCPTQTYVKYQVPCQTQTYVKC      1 - 70
PAPCQRTYVKYPTPCQTYVKCPAPCQTTYVKCPTPCQTYVKCPAPCQMTYIKSPAPCQTQTCYVQGASPC     71 - 140
QSYYVQAPASGSTSQYCVTDPCSAPCSTSYCCLAPRTFGVSPLRRWIQRPQNCNTGSSGCCENSGSSGCC    141 - 210
GSGGCGCSCGCGSSGCCCLGIIPMRSRGPACCDHEDDCCC                                  211 - 250
//

Text Mined References (9)

PMID Year Title
25197941 2014 Immunochip SNP array identifies novel genetic variants conferring susceptibility to candidaemia.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
20200978 2010 Replication of previous genome-wide association studies of bone mineral density in premenopausal American women.
17562024 2007 Large-scale identification of human genes implicated in epidermal barrier function.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
11698679 2001 Differentially expressed late constituents of the epidermal cornified envelope.
11181995 2001 The sequence of the human genome.
9344646 1997 Positional cloning of novel skin-specific genes from the human epidermal differentiation complex.