Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.25
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
Atopic dermatitis 952 2.6e-06
psoriasis 6694 1.8e-02

Expression

  Differential Expression (2)

Disease log2 FC p
Atopic dermatitis -3.100 2.6e-06
psoriasis -1.400 1.8e-02

Gene RIF (2)

AA Sequence

MCDQQKQPQFPPSCVKGSGLGAGQGSNGASVKCPVPCQTQTVCVTGPAPCPTQTYVKYQVPCQTQTYVKC      1 - 70
PAPCQRTYVKYPTPCQTYVKCPAPCQTTYVKCPTPCQTYVKCPAPCQMTYIKSPAPCQTQTCYVQGASPC     71 - 140
QSYYVQAPASGSTSQYCVTDPCSAPCSTSYCCLAPRTFGVSPLRRWIQRPQNCNTGSSGCCENSGSSGCC    141 - 210
GSGGCGCSCGCGSSGCCCLGIIPMRSRGPACCDHEDDCCC                                  211 - 250
//

Text Mined References (9)

PMID Year Title