Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.65
PubTator Score 0.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 2.3e-07
lung carcinoma 2843 1.1e-03

Expression

  Differential Expression (2)

Disease log2 FC p
lung carcinoma -1.200 1.1e-03
psoriasis -1.400 2.3e-07

AA Sequence

MNKVFPQGENGYTAAESKAHPGGEAGGGHLCCSRRGACLSASLLLLLATVAALIALVTILGLPSCTPGAQ      1 - 70
ACITLTNRTGFLCHDQRSCIPASGVCDGVRTCTHGEDEDESLCRDVPQSLPHFLVAHCGDPASWIYSDQK     71 - 140
CDGTNNCGDCSDELSPVTVCPPCGPGWWRCPSTFFKYCDCIPRHLCRDHVQHCSDWSDEYACPGP         141 - 205
//

Text Mined References (5)

PMID Year Title