Property Summary

NCBI Gene PubMed Count 21
Grant Count 7
R01 Count 7
Funding $625,862.5
PubMed Score 46.61
PubTator Score 29.83

Knowledge Summary

Patent (3,247)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Prostate cancer 172 3.213 1.6

Gene RIF (15)

PMID Text
26735260 results suggest that G protein-coupled receptor class C group 6 member A(GPRC6A) inactivation or sub-function contributes to reduced exposure to androgens, leading to cryptorchidism during fetal life and/or low sperm production in adulthood
26537068 association of the THADA, FOXP4, GPRC6A/RFX6 and 8q24 genes with prostate cancer in Asian populations.
25164816 Duox1 activity is stimulated by testosterone through GPRC6A in skin keratinocytes
24651445 The present experiments demonstrated a critical role for the GPRC6A-ERK1/2 and PI3K/Akt signaling pathway in arginine-mediated fibroblast survival.
23728177 The F464Y substitution in GPRC6A may be a cause of primary testicular failure.
23271661 Extracellular Ca2+ activates the NLRP3 inflammasome via CaSR and GPRC6A.
23269670 the GPRC6A receptor functions as an amino acid sensor in GLUTag cells that promotes GLP-1 secretion
22662242 Our results provide further support for association of the C2orf43, FOXP4, GPRC6A and RFX6 genes with prostate cancer in Eastern Asian populations
21681779 GPRC6A is a novel molecular target for regulating prostate growth and cancer progression.
20676098 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAFLIILITCFVIILATSQPCQTPDDFVAATSPGHIIIGGLFAIHEKMLSSEDSPRRPQIQECVGFEISV      1 - 70
FLQTLAMIHSIEMINNSTLLPGVKLGYEIYDTCTEVTVAMAATLRFLSKFNCSRETVEFKCDYSSYMPRV     71 - 140
KAVIGSGYSEITMAVSRMLNLQLMPQVGYESTAEILSDKIRFPSFLRTVPSDFHQIKAMAHLIQKSGWNW    141 - 210
IGIITTDDDYGRLALNTFIIQAEANNVCIAFKEVLPAFLSDNTIEVRINRTLKKIILEAQVNVIVVFLRQ    211 - 280
FHVFDLFNKAIEMNINKMWIASDNWSTATKITTIPNVKKIGKVVGFAFRRGNISSFHSFLQNLHLLPSDS    281 - 350
HKLLHEYAMHLSACAYVKDTDLSQCIFNHSQRTLAYKANKAIERNFVMRNDFLWDYAEPGLIHSIQLAVF    351 - 420
ALGYAIRDLCQARDCQNPNAFQPWELLGVLKNVTFTDGWNSFHFDAHGDLNTGYDVVLWKEINGHMTVTK    421 - 490
MAEYDLQNDVFIIPDQETKNEFRNLKQIQSKCSKECSPGQMKKTTRSQHICCYECQNCPENHYTNQTDMP    491 - 560
HCLLCNNKTHWAPVRSTMCFEKEVEYLNWNDSLAILLLILSLLGIIFVLVVGIIFTRNLNTPVVKSSGGL    561 - 630
RVCYVILLCHFLNFASTSFFIGEPQDFTCKTRQTMFGVSFTLCISCILTKSLKILLAFSFDPKLQKFLKC    631 - 700
LYRPILIIFTCTGIQVVICTLWLIFAAPTVEVNVSLPRVIILECEEGSILAFGTMLGYIAILAFICFIFA    701 - 770
FKGKYENYNEAKFITFGMLIYFIAWITFIPIYATTFGKYVPAVEIIVILISNYGILYCTFIPKCYVIICK    771 - 840
QEINTKSAFLKMIYSYSSHSVSSIALSPASLDSMSGNVTMTNPSSSGKSATWQKSKDLQAQAFAHICREN    841 - 910
ATSVSKTLPRKRMSSI                                                          911 - 926
//

Text Mined References (22)

PMID Year Title
26735260 2016 Polymorphism rs2274911 of GPRC6A as a Novel Risk Factor for Testis Failure.
26537068 Association of THADA, FOXP4, GPRC6A/RFX6 genes and 8q24 risk alleles with prostate cancer in Northern Chinese men.
25164816 2014 Testosterone stimulates Duox1 activity through GPRC6A in skin keratinocytes.
24651445 2014 L-arginine stimulates fibroblast proliferation through the GPRC6A-ERK1/2 and PI3K/Akt pathway.
23728177 2013 Osteocalcin regulates murine and human fertility through a pancreas-bone-testis axis.
23271661 2012 Extracellular Ca2+ is a danger signal activating the NLRP3 inflammasome through G protein-coupled calcium sensing receptors.
23269670 2013 The G protein-coupled receptor family C group 6 subtype A (GPRC6A) receptor is involved in amino acid-induced glucagon-like peptide-1 secretion from GLUTag cells.
22662242 2012 Replication and fine mapping for association of the C2orf43, FOXP4, GPRC6A and RFX6 genes with prostate cancer in the Chinese population.
21681779 2012 GPRC6A regulates prostate cancer progression.
21300955 2011 Meta-analysis of genome-wide association studies in >80 000 subjects identifies multiple loci for C-reactive protein levels.
More...