Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.16
PubTator Score 1.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 3.49105104324264E-8
Pick disease 1893 7.20890458571278E-8
osteosarcoma 7933 5.8567441890723E-6
ovarian cancer 8492 1.07549592222768E-5
hepatocellular carcinoma 550 1.45122663041531E-5
glioblastoma 5572 4.57182433997008E-5
pilocytic astrocytoma 3086 1.02701950182978E-4
group 4 medulloblastoma 1875 6.04356832407333E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 7.37134503104303E-4
diabetes mellitus 1663 0.00145430918826872
tuberculosis and treatment for 6 months 686 0.00163103451551492
oligodendroglioma 2849 0.00233472156369774
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0064376003453004
pancreatic cancer 2300 0.0071062246158144
pancreatic carcinoma 567 0.0071062246158144
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00733700536476787
astrocytic glioma 2241 0.00783995032910056
gastric cancer 436 0.00806452553059601
acute myeloid leukemia 785 0.00929494178007699
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00945177861494652
pediatric high grade glioma 2712 0.0114964243780932

Expression

Synonym

Accession Q5T6V5 B2RPI6 Q8N2B1 Q9BT18
Symbols

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid

 GO Process (1)

 Compartment GO Term (1)

AA Sequence

MDGLLNPRESSKFIAENSRDVFIDSGGVRRVAELLLAKAAGPELRVEGWKALHELNPRAADEAAVNWVFV      1 - 70
TDTLNFSFWSEQDEHKCVVRYRGKTYSGYWSLCAAVNRALDEGIPITSASYYATVTLDQVRNILRSDTDV     71 - 140
SMPLVEERHRILNETGKILLEKFGGSFLNCVRESENSAQKLMHLVVESFPSYRDVTLFEGKRVSFYKRAQ    141 - 210
ILVADTWSVLEGKGDGCFKDISSITMFADYRLPQVLAHLGALKYSDDLLKKLLKGEMLSYGDRQEVEIRG    211 - 280
CSLWCVELIRDCLLELIEQKGEKPNGEINSILLDYYLWDYAHDHREDMKGIPFHRIRCIYY             281 - 341
//

Text Mined References (9)

PMID Year Title
24911101 2014 Plant, animal, and fungal micronutrient queuosine is salvaged by members of the DUF2419 protein family.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20354154 2010 Characterization of the human tRNA-guanine transglycosylase: confirmation of the heterodimeric subunit structure.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.