Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.16
PubTator Score 1.26

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q5T6V5 B2RPI6 Q8N2B1 Q9BT18
Symbols

Gene

 GO Process (1)

 Compartment GO Term (0)

AA Sequence

MDGLLNPRESSKFIAENSRDVFIDSGGVRRVAELLLAKAAGPELRVEGWKALHELNPRAADEAAVNWVFV      1 - 70
TDTLNFSFWSEQDEHKCVVRYRGKTYSGYWSLCAAVNRALDEGIPITSASYYATVTLDQVRNILRSDTDV     71 - 140
SMPLVEERHRILNETGKILLEKFGGSFLNCVRESENSAQKLMHLVVESFPSYRDVTLFEGKRVSFYKRAQ    141 - 210
ILVADTWSVLEGKGDGCFKDISSITMFADYRLPQVLAHLGALKYSDDLLKKLLKGEMLSYGDRQEVEIRG    211 - 280
CSLWCVELIRDCLLELIEQKGEKPNGEINSILLDYYLWDYAHDHREDMKGIPFHRIRCIYY             281 - 341
//

Text Mined References (9)

PMID Year Title
24911101 2014 Plant, animal, and fungal micronutrient queuosine is salvaged by members of the DUF2419 protein family.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20354154 2010 Characterization of the human tRNA-guanine transglycosylase: confirmation of the heterodimeric subunit structure.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.