Property Summary

NCBI Gene PubMed Count 18
PubMed Score 55.41
PubTator Score 62.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
glioblastoma 1.200 9.6e-06
group 3 medulloblastoma 1.200 4.0e-03
inflammatory breast cancer 1.400 6.6e-03
intraductal papillary-mucinous neoplasm ... 2.000 2.4e-03
lung adenocarcinoma 1.900 5.8e-12
non-small cell lung cancer 1.029 6.6e-11
osteosarcoma -1.671 8.4e-03
pediatric high grade glioma 1.200 8.7e-05
psoriasis 1.100 2.4e-14
ulcerative colitis 1.200 8.3e-05

Gene RIF (7)

AA Sequence

MENRALDPGTRDSYGATSHLPNKGALAKVKNNFKDLMSKLTEGQYVLCRWTDGLYYLGKIKRVSSSKQSC      1 - 70
LVTFEDNSKYWVLWKDIQHAGVPGEEPKCNICLGKTSGPLNEILICGKCGLGYHQQCHIPIAGSADQPLL     71 - 140
TPWFCRRCIFALAVRKGGALKKGAIARTLQAVKMVLSYQPEELEWDSPHRTNQQQCYCYCGGPGEWYLRM    141 - 210
LQCYRCRQWFHEACTQCLNEPMMFGDRFYLFFCSVCNQGPEYIERLPLRWVDVVHLALYNLGVQSKKKYF    211 - 280
DFEEILAFVNHHWELLQLGKLTSTPVTDRGPHLLNALNSYKSRFLCGKEIKKKKCIFRLRIRVPPNPPGK    281 - 350
LLPDKGLLPNENSASSELRKRGKSKPGLLPHEFQQQKRRVYRRKRSKFLLEDAIPSSDFTSAWSTNHHLA    351 - 420
SIFDFTLDEIQSLKSASSGQTFFSDVDSTDAASTSGSASTSLSYDSRWTVGSRKRKLAAKAYMPLRAKRW    421 - 490
AAELDGRCPSDSSAEGASVPERPDEGIDSHTFESISEDDSSLSHLKSSITNYFGAAGRLACGEKYQVLAR    491 - 560
RVTPEGKVQYLVEWEGTTPY                                                      561 - 580
//

Text Mined References (23)

PMID Year Title