Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q5T6M2 Q0VD89 Q96N37
Symbols C6orf122
NCRNA00242
dJ266L20.5

 Compartment GO Term (0)

AA Sequence

MMPRHLLPHSGITSLRRVPRRRLPSRRREDFRRCLFLSFVSTDKDGDPTGQASPAVPVPHFTTWGSLIPI      1 - 70
DSQRNKERTRFTWMDGPPHGGLGTRFSGRGSASLTAPPGRCFTRERHPVPRQRKCRRQHSTGRKPHCGTR     71 - 140
SAAPRNPKSIHKRSFSAKSLKNKTRNESPPVSALVSRTKTQPGQLHFCCQPSSSQAPASRRAKGR         141 - 205
//

Text Mined References (5)

PMID Year Title