Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.56
PubTator Score 2.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Periventricular nodular heterotopia 30 5.014 2.5
Disease Target Count P-value
ovarian cancer 8520 1.9e-11
Pick disease 1894 6.1e-06
osteosarcoma 7950 2.7e-05
progressive supranuclear palsy 676 7.0e-03
Disease Target Count Z-score Confidence
Visceral leishmaniasis 14 3.389 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.661 2.7e-05
ovarian cancer -1.600 1.9e-11
Pick disease -1.200 6.1e-06
progressive supranuclear palsy -1.200 7.0e-03

Gene RIF (1)

AA Sequence

MEVLIGDPITTCLSPSVYDIICNLGFQLRENCDINSIVTQNGEVCWKTITDCVSYTESEQGLDYWGSVRL      1 - 70
LGPVCEAVHSHFLSLTKGQFEIRYAPWFQWTSFPELFPEIFDALESLQSPAISLSLMKLTSCLERALGDV     71 - 140
FLLIGKECPFLLRDLLSSEELAQVFSQSVMNVLKVFVGSPCGLNLRNVLWHGFASPEEIPPKYCSMMILL    141 - 210
TAGLGQLLKSYLQNTKLTLAHRSFISLTNLEDLIVFPDVTYEVLSVLEEVMMKSAFILKIMLPYWEVALV    211 - 280
KFKSHRFADCAILLLTQLETGLRNVFATLNRCPKRLLTAESTALYTTFDQILAKHLNDGKINQLPLFLGE    281 - 350
PAMEFLWDFLNHQEGPRIRDHLSHGEINLHEFSKETTNQLLAFSLVLLLRFVDDCLLSVFKEKSAVELLI    351 - 420
SLAEGYSSRCHPVFQLKKQVLSCEESIRVWALLPFPEELTRQAVRLEDNSETNACHSLITKMTDELYHHM    421 - 490
PENRCVLKDLDRLPTETWPQLLRELCSTPVPTLFCPRIVLEVLVVLRSISEQCRRVSSQVTVASELRHRQ    491 - 560
WVERTLRSRQRQNYLRMWSSIRLLSPVLSLILLLIALELVNIHAVCGKNAHEYQQYLKFVKSILQYTENL    561 - 630
VAYTSYEKNKWNETINLTHTALLKMWTFSEKKQMLIHLAKKSTSKVLL                          631 - 678
//

Text Mined References (8)

PMID Year Title