Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.55
PubTator Score 2.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
ovarian cancer 8492 1.85076105464528E-11
osteosarcoma 7933 9.14799832396613E-8
Pick disease 1893 6.1490696193855E-6
progressive supranuclear palsy 674 0.00702506105540677
Disease Target Count Z-score Confidence
Visceral leishmaniasis 14 3.498 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.800 0.000
Pick disease -1.200 0.000
progressive supranuclear palsy -1.200 0.007
ovarian cancer -1.600 0.000

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG
Chicken OMA EggNOG
Xenopus OMA EggNOG

Gene RIF (1)

PMID Text
24056535 C6orf70 plays a major role in the control of neuronal migration; its haploinsufficiency or mutation causes periventricular nodular heterotopia.

AA Sequence

MEVLIGDPITTCLSPSVYDIICNLGFQLRENCDINSIVTQNGEVCWKTITDCVSYTESEQGLDYWGSVRL      1 - 70
LGPVCEAVHSHFLSLTKGQFEIRYAPWFQWTSFPELFPEIFDALESLQSPAISLSLMKLTSCLERALGDV     71 - 140
FLLIGKECPFLLRDLLSSEELAQVFSQSVMNVLKVFVGSPCGLNLRNVLWHGFASPEEIPPKYCSMMILL    141 - 210
TAGLGQLLKSYLQNTKLTLAHRSFISLTNLEDLIVFPDVTYEVLSVLEEVMMKSAFILKIMLPYWEVALV    211 - 280
KFKSHRFADCAILLLTQLETGLRNVFATLNRCPKRLLTAESTALYTTFDQILAKHLNDGKINQLPLFLGE    281 - 350
PAMEFLWDFLNHQEGPRIRDHLSHGEINLHEFSKETTNQLLAFSLVLLLRFVDDCLLSVFKEKSAVELLI    351 - 420
SLAEGYSSRCHPVFQLKKQVLSCEESIRVWALLPFPEELTRQAVRLEDNSETNACHSLITKMTDELYHHM    421 - 490
PENRCVLKDLDRLPTETWPQLLRELCSTPVPTLFCPRIVLEVLVVLRSISEQCRRVSSQVTVASELRHRQ    491 - 560
WVERTLRSRQRQNYLRMWSSIRLLSPVLSLILLLIALELVNIHAVCGKNAHEYQQYLKFVKSILQYTENL    561 - 630
VAYTSYEKNKWNETINLTHTALLKMWTFSEKKQMLIHLAKKSTSKVLL                          631 - 678
//

Text Mined References (8)

PMID Year Title
24056535 2013 Periventricular heterotopia in 6q terminal deletion syndrome: role of the C6orf70 gene.
23768067 2013 Comprehensive analysis of the HEPN superfamily: identification of novel roles in intra-genomic conflicts, defense, pathogenesis and RNA processing.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.