Property Summary

NCBI Gene PubMed Count 6
PubMed Score 9.91
PubTator Score 2.06

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
adrenocortical carcinoma -1.129 6.5e-09
non-small cell lung cancer -1.043 8.5e-16
osteosarcoma -1.473 1.1e-04
posterior fossa group B ependymoma 1.200 1.9e-09

Synonym

Accession Q5T6J7 A5PLN6 Q5T6J6
Symbols hGntK
C9orf103
bA522I20.2

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (1)

AA Sequence

MAAPGALLVMGVSGSGKSTVGALLASELGWKFYDADDYHPEENRRKMGKGIPLNDQDRIPWLCNLHDILL      1 - 70
RDVASGQRVVLACSALKKTYRDILTQGKDGVALKCEESGKEAKQAEMQLLVVHLSGSFEVISGRLLKREG     71 - 140
HFMPPELLQSQFETLEPPAAPENFIQISVDKNVSEIIATIMETLKMK                           141 - 187
//

Text Mined References (10)

PMID Year Title