Property Summary

NCBI Gene PubMed Count 17
PubMed Score 2.65
PubTator Score 2.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.225 0.031
Multiple myeloma 1.189 0.006
osteosarcoma -1.363 0.002
astrocytoma 1.100 0.033
pancreatic ductal adenocarcinoma liver m... 1.743 0.003
lung cancer 2.000 0.008
colon cancer 1.200 0.032
spina bifida -1.383 0.017
ovarian cancer 1.500 0.000

Gene RIF (4)

PMID Text
25631074 Cellular biotinylated ubiquitin associated protein 2 (UBAP2) is incorporated into HIV-1 Gag virus-like particles
23739027 By incorporating the information from bioinformatics and RNA expression analyses, we identified at least two of the most promising risk genes for alcohol dependence: APOER2 and UBAP2
20670673 Observational study of gene-disease association. (HuGE Navigator)
19446021 UBAP2 serves as a host gene for snoRNAs

AA Sequence

MMTSVSSDHCRGAREKPQISAAQSTQPQKQVVQATAEQMRLAQVIFDKNDSDFEAKVKQLMEVTGKNQDE      1 - 70
CIVALHDCNGDVNKAINILLEGNSDTTSWETVGCKKKNFAKENSENKENREKKSEKESSRGRGNNNRKGR     71 - 140
GGNRGREFRGEENGIDCNQVDKPSDRGKRARGRGFGRGRGRGAGRFSTQGMGTFNPADYSDSTSTDVCGT    141 - 210
KLVVWEAAQNGADEGTELASNTHNIAQDLSNKSSYGLKGAWKNSVEEWTTEDWTEDLSETKVFTASSAPA    211 - 280
ENHILPGQSIDLVALLQKPVPHSQASEANSFETSQQQGFGQALVFTNSQHNNQMAPGTGSSTAVNSCSPQ    281 - 350
SLSSVLGSGFGELAPPKMANITSSQILDQLKAPSLGQFTTTPSTQQNSTSHPTTTTSWDLKPPTSQSSVL    351 - 420
SHLDFKSQPEPSPVLSQLSQRQQHQSQAVTVPPPGLESFPSQAKLRESTPGDSPSTVNKLLQLPSTTIEN    421 - 490
ISVSVHQPQPKHIKLAKRRIPPASKIPASAVEMPGSADVTGLNVQFGALEFGSEPSLSEFGSAPSSENSN    491 - 560
QIPISLYSKSLSEPLNTSLSMTSAVQNSTYTTSVITSCSLTSSSLNSASPVAMSSSYDQSSVHNRIPYQS    561 - 630
PVSSSESAPGTIMNGHGGGRSQQTLDTPKTTGPPSALPSVSSLPSTTSCTALLPSTSQHTGDLTSSPLSQ    631 - 700
LSSSLSSHQSSLSAHAALSSSTSHTHASVESASSHQSSATFSTAATSVSSSASSGASLSSSMNTANSLCL    701 - 770
GGTPASASSSSSRAAPLVTSGKAPPNLPQGVPPLLHNQYLVGPGGLLPAYPIYGYDELQMLQSRLPVDYY    771 - 840
GIPFAAPTALASRDGSLANNPYPGDVTKFGRGDSASPAPATTPAQPQQSQSQTHHTAQQPFVNPALPPGY    841 - 910
SYTGLPYYTGMPSAFQYGPTMFVPPASAKQHGVNLSTPTPPFQQASGYGQHGYSTGYDDLTQGTAAGDYS    911 - 980
KGGYAGSSQAPNKSAGSGPGKGVSVSSSTTGLPDMTGSVYNKTQTFDKQGFHAGTPPPFSLPSVLGSTGP    981 - 1050
LASGAAPGYAPPPFLHILPAHQQPHSQLLHHHLPQDAQSGSGQRSQPSSLQPKSQASKPAYGNSPYWTN    1051 - 1119
//

Text Mined References (22)

PMID Year Title
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23739027 2013 Exome-wide association study of replicable nonsynonymous variants conferring risk for alcohol dependence.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20670673 2010 Is KIF24 a genetic risk factor for Frontotemporal Lobar Degeneration?
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19446021 2009 Eukaryotic snoRNAs: a paradigm for gene expression flexibility.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...