Property Summary

NCBI Gene PubMed Count 17
PubMed Score 2.65
PubTator Score 2.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 4.35457271712275E-4
osteosarcoma 7933 0.00214410946367193
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00331597386564301
Multiple myeloma 1328 0.0058310716382323
lung cancer 4473 0.00772296695392773
spina bifida 1064 0.0165213520016134
Waldenstrons macroglobulinemia 765 0.031055798361997
colon cancer 1475 0.0321331656083631
astrocytoma 1493 0.0327796818789319

Expression

  Differential Expression (9)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.225 0.031
Multiple myeloma 1.189 0.006
osteosarcoma -1.363 0.002
astrocytoma 1.100 0.033
pancreatic ductal adenocarcinoma liver m... 1.743 0.003
lung cancer 2.000 0.008
colon cancer 1.200 0.032
spina bifida -1.383 0.017
ovarian cancer 1.500 0.000

Synonym

Accession Q5T6F2 Q2M2R4 Q5JV03 Q6PK34 Q8NC94 Q9P237 UBAP-2
Symbols UBAP-2

Gene

  Ortholog (11)

Gene RIF (4)

PMID Text
25631074 Cellular biotinylated ubiquitin associated protein 2 (UBAP2) is incorporated into HIV-1 Gag virus-like particles
23739027 By incorporating the information from bioinformatics and RNA expression analyses, we identified at least two of the most promising risk genes for alcohol dependence: APOER2 and UBAP2
20670673 Observational study of gene-disease association. (HuGE Navigator)
19446021 UBAP2 serves as a host gene for snoRNAs

AA Sequence

MMTSVSSDHCRGAREKPQISAAQSTQPQKQVVQATAEQMRLAQVIFDKNDSDFEAKVKQLMEVTGKNQDE      1 - 70
CIVALHDCNGDVNKAINILLEGNSDTTSWETVGCKKKNFAKENSENKENREKKSEKESSRGRGNNNRKGR     71 - 140
GGNRGREFRGEENGIDCNQVDKPSDRGKRARGRGFGRGRGRGAGRFSTQGMGTFNPADYSDSTSTDVCGT    141 - 210
KLVVWEAAQNGADEGTELASNTHNIAQDLSNKSSYGLKGAWKNSVEEWTTEDWTEDLSETKVFTASSAPA    211 - 280
ENHILPGQSIDLVALLQKPVPHSQASEANSFETSQQQGFGQALVFTNSQHNNQMAPGTGSSTAVNSCSPQ    281 - 350
SLSSVLGSGFGELAPPKMANITSSQILDQLKAPSLGQFTTTPSTQQNSTSHPTTTTSWDLKPPTSQSSVL    351 - 420
SHLDFKSQPEPSPVLSQLSQRQQHQSQAVTVPPPGLESFPSQAKLRESTPGDSPSTVNKLLQLPSTTIEN    421 - 490
ISVSVHQPQPKHIKLAKRRIPPASKIPASAVEMPGSADVTGLNVQFGALEFGSEPSLSEFGSAPSSENSN    491 - 560
QIPISLYSKSLSEPLNTSLSMTSAVQNSTYTTSVITSCSLTSSSLNSASPVAMSSSYDQSSVHNRIPYQS    561 - 630
PVSSSESAPGTIMNGHGGGRSQQTLDTPKTTGPPSALPSVSSLPSTTSCTALLPSTSQHTGDLTSSPLSQ    631 - 700
LSSSLSSHQSSLSAHAALSSSTSHTHASVESASSHQSSATFSTAATSVSSSASSGASLSSSMNTANSLCL    701 - 770
GGTPASASSSSSRAAPLVTSGKAPPNLPQGVPPLLHNQYLVGPGGLLPAYPIYGYDELQMLQSRLPVDYY    771 - 840
GIPFAAPTALASRDGSLANNPYPGDVTKFGRGDSASPAPATTPAQPQQSQSQTHHTAQQPFVNPALPPGY    841 - 910
SYTGLPYYTGMPSAFQYGPTMFVPPASAKQHGVNLSTPTPPFQQASGYGQHGYSTGYDDLTQGTAAGDYS    911 - 980
KGGYAGSSQAPNKSAGSGPGKGVSVSSSTTGLPDMTGSVYNKTQTFDKQGFHAGTPPPFSLPSVLGSTGP    981 - 1050
LASGAAPGYAPPPFLHILPAHQQPHSQLLHHHLPQDAQSGSGQRSQPSSLQPKSQASKPAYGNSPYWTN    1051 - 1119
//

Text Mined References (22)

PMID Year Title
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23739027 2013 Exome-wide association study of replicable nonsynonymous variants conferring risk for alcohol dependence.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20670673 2010 Is KIF24 a genetic risk factor for Frontotemporal Lobar Degeneration?
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19446021 2009 Eukaryotic snoRNAs: a paradigm for gene expression flexibility.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...