Property Summary

NCBI Gene PubMed Count 11
PubMed Score 7.93
PubTator Score 2.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
acute myeloid leukemia -2.100 2.6e-02
ependymoma 1.600 1.0e-02
hepatocellular carcinoma 1.400 5.8e-06
osteosarcoma -1.638 1.2e-02
ovarian cancer -1.200 2.3e-04
pancreatic cancer 1.400 8.7e-04
pancreatic carcinoma 1.400 8.7e-04
tuberculosis and treatment for 6 months -1.600 6.2e-04

Protein-protein Interaction (9)

Gene RIF (2)

AA Sequence

MARKVVSRKRKAPASPGAGSDAQGPQFGWDHSLHKRKRLPPVKRSLVYYLKNREVRLQNETSYSRVLHGY      1 - 70
AAQQLPSLLKEREFHLGTLNKVFASQWLNHRQVVCGTKCNTLFVVDVQTSQITKIPILKDREPGGVTQQG     71 - 140
CGIHAIELNPSRTLLATGGDNPNSLAIYRLPTLDPVCVGDDGHKDWIFSIAWISDTMAVSGSRDGSMGLW    141 - 210
EVTDDVLTKSDARHNVSRVPVYAHITHKALKDIPKEDTNPDNCKVRALAFNNKNKELGAVSLDGYFHLWK    211 - 280
AENTLSKLLSTKLPYCRENVCLAYGSEWSVYAVGSQAHVSFLDPRQPSYNVKSVCSRERGSGIRSVSFYE    281 - 350
HIITVGTGQGSLLFYDIRAQRFLEERLSACYGSKPRLAGENLKLTTGKGWLNHDETWRNYFSDIDFFPNA    351 - 420
VYTHCYDSSGTKLFVAGGPLPSGLHGNYAGLWS                                         421 - 453
//

Text Mined References (17)

PMID Year Title