Property Summary

NCBI Gene PubMed Count 11
PubMed Score 7.78
PubTator Score 2.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
hepatocellular carcinoma 550 5.75378444033572E-6
tuberculosis and treatment for 6 months 686 6.18348463684234E-4
pancreatic cancer 2300 8.68915715376427E-4
pancreatic carcinoma 567 8.68915715376427E-4
ovarian cancer 8492 0.00112576400182733
ependymoma 2514 0.0102349186959721
osteosarcoma 7933 0.0115378540958672
acute myeloid leukemia 785 0.0255825710228728

Expression

  Differential Expression (8)

Disease log2 FC p
hepatocellular carcinoma 1.400 0.000
pancreatic cancer 1.400 0.001
ependymoma 1.600 0.010
osteosarcoma -1.638 0.012
tuberculosis and treatment for 6 months -1.600 0.001
pancreatic carcinoma 1.400 0.001
acute myeloid leukemia -2.100 0.026
ovarian cancer 1.700 0.001

Synonym

Accession Q5T6F0 A8KA70 D3DRL6 Q5T6E9 Q5T6F1 Q6P3V0 Q7L4F8 Q96PZ5 Q9NXA9 Q9UFJ1
Symbols CT102
TCC52
WDR40A
KIAA1892

Gene

PDB

3I7P  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (2)

PMID Text
18957058 TCC52, as a novel CT antigen, would be a promising candidate for cancer immunotherapy.
18096478 Of the classifier's 11 informative genes, expression of MIR and WDR40 showed statistically significant increases for both Grade 1B and Grade >or=3A rejection.

AA Sequence

MARKVVSRKRKAPASPGAGSDAQGPQFGWDHSLHKRKRLPPVKRSLVYYLKNREVRLQNETSYSRVLHGY      1 - 70
AAQQLPSLLKEREFHLGTLNKVFASQWLNHRQVVCGTKCNTLFVVDVQTSQITKIPILKDREPGGVTQQG     71 - 140
CGIHAIELNPSRTLLATGGDNPNSLAIYRLPTLDPVCVGDDGHKDWIFSIAWISDTMAVSGSRDGSMGLW    141 - 210
EVTDDVLTKSDARHNVSRVPVYAHITHKALKDIPKEDTNPDNCKVRALAFNNKNKELGAVSLDGYFHLWK    211 - 280
AENTLSKLLSTKLPYCRENVCLAYGSEWSVYAVGSQAHVSFLDPRQPSYNVKSVCSRERGSGIRSVSFYE    281 - 350
HIITVGTGQGSLLFYDIRAQRFLEERLSACYGSKPRLAGENLKLTTGKGWLNHDETWRNYFSDIDFFPNA    351 - 420
VYTHCYDSSGTKLFVAGGPLPSGLHGNYAGLWS                                         421 - 453
//

Text Mined References (17)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19343178 2009 Meta-analysis of genome-wide scans for human adult stature identifies novel Loci and associations with measures of skeletal frame size.
19295130 2009 An interaction network of the mammalian COP9 signalosome identifies Dda1 as a core subunit of multiple Cul4-based E3 ligases.
18957058 2008 Novel centrosome protein, TCC52, is a cancer-testis antigen.
18096478 2007 Gene expression profiling distinguishes a molecular signature for grade 1B mild acute cellular rejection in cardiac allograft recipients.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16964240 2006 Molecular architecture and assembly of the DDB1-CUL4A ubiquitin ligase machinery.
16949367 2006 A family of diverse Cul4-Ddb1-interacting proteins includes Cdt2, which is required for S phase destruction of the replication factor Cdt1.
16341674 2005 Transcriptome analysis of human gastric cancer.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
More...