Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.81
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 2.90825344171591E-17
non-small cell lung cancer 2798 2.41012918562772E-11
pituitary cancer 1972 2.46834311797102E-7
adrenocortical carcinoma 1427 3.38106769699196E-7
glioblastoma 5572 6.82555150265213E-7
pilocytic astrocytoma 3086 9.05454876905783E-7
pediatric high grade glioma 2712 2.6917692137415E-6
hepatocellular carcinoma 550 3.11193401854109E-6
group 3 medulloblastoma 2254 3.93218975356464E-6
lung cancer 4473 1.03766573398626E-4
primitive neuroectodermal tumor 3031 1.30645370496897E-4
lung adenocarcinoma 2714 2.68413205328614E-4
inflammatory breast cancer 404 0.00108363301325073
ductal carcinoma in situ 1745 0.00124442732357687
breast carcinoma 1614 0.00146835155318427
invasive ductal carcinoma 2950 0.00445537643759986
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00472724985402333
urothelial carcinoma 318 0.0057433510087048
active Crohn's disease 918 0.00798586213001576
ependymoma 2514 0.00897689150289938
colon cancer 1475 0.0104293098136983
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0149944970523509
spina bifida 1064 0.0198710519445655
fibroadenoma 557 0.042615127452168

Expression

  Differential Expression (24)

Disease log2 FC p
hepatocellular carcinoma -1.200 0.000
urothelial carcinoma -1.200 0.006
ependymoma -1.100 0.009
glioblastoma -1.100 0.000
group 3 medulloblastoma -2.000 0.000
primitive neuroectodermal tumor -1.200 0.000
adrenocortical carcinoma -1.975 0.000
non-small cell lung cancer -1.042 0.000
intraductal papillary-mucinous adenoma (... 1.600 0.005
intraductal papillary-mucinous neoplasm ... 1.500 0.015
lung cancer -2.100 0.000
colon cancer -1.900 0.010
active Crohn's disease -1.342 0.008
breast carcinoma -1.300 0.001
fibroadenoma -1.600 0.043
pediatric high grade glioma -1.100 0.000
pilocytic astrocytoma -1.100 0.000
lung adenocarcinoma -1.060 0.000
inflammatory breast cancer -1.200 0.001
lung carcinoma -1.300 0.000
spina bifida -1.700 0.020
ductal carcinoma in situ -1.200 0.001
invasive ductal carcinoma -1.100 0.004
pituitary cancer -1.300 0.000

Synonym

Accession Q5T686 Q53G32 Q9H2R9 Q9HBN9 AVP-induced protein 1
Symbols VIP32
VIT32
PP5395

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Anole lizard EggNOG Inparanoid
Xenopus EggNOG Inparanoid

Gene RIF (1)

PMID Text
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGTPASVVSEPPPWQAPIEARGRKQASANIFQDAELLQIQALFQRSGDQLAEERAQIIWECAGDHRVAEA      1 - 70
LKRLRRKRPPRQKPLGHSLHHCSRLRILEPHSALANPQSATETASSEQYLHSRKKSARIRRNWRKSGPTS     71 - 140
YLHQIRH                                                                   141 - 147
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21516116 2011 Next-generation sequencing to generate interactome datasets.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15140762 2004 AVP-induced VIT32 gene expression in collecting duct cells occurs via trans-activation of a CRE in the 5'-flanking region of the VIT32 gene.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12356727 2002 A novel vasopressin-induced transcript promotes MAP kinase activation and ENaC downregulation.
9110174 1997 Large-scale concatenation cDNA sequencing.
More...