Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.81
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
hepatocellular carcinoma -1.200 0.000
urothelial carcinoma -1.200 0.006
ependymoma -1.100 0.009
glioblastoma -1.100 0.000
group 3 medulloblastoma -2.000 0.000
primitive neuroectodermal tumor -1.200 0.000
adrenocortical carcinoma -1.975 0.000
non-small cell lung cancer -1.042 0.000
intraductal papillary-mucinous adenoma (... 1.600 0.005
intraductal papillary-mucinous neoplasm ... 1.500 0.015
lung cancer -2.100 0.000
colon cancer -1.900 0.010
active Crohn's disease -1.342 0.008
breast carcinoma -1.300 0.001
fibroadenoma -1.600 0.043
pediatric high grade glioma -1.100 0.000
pilocytic astrocytoma -1.100 0.000
lung adenocarcinoma -1.060 0.000
inflammatory breast cancer -1.200 0.001
lung carcinoma -1.300 0.000
spina bifida -1.700 0.020
ductal carcinoma in situ -1.200 0.001
invasive ductal carcinoma -1.100 0.004
pituitary cancer -1.300 0.000

Gene RIF (1)

PMID Text
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGTPASVVSEPPPWQAPIEARGRKQASANIFQDAELLQIQALFQRSGDQLAEERAQIIWECAGDHRVAEA      1 - 70
LKRLRRKRPPRQKPLGHSLHHCSRLRILEPHSALANPQSATETASSEQYLHSRKKSARIRRNWRKSGPTS     71 - 140
YLHQIRH                                                                   141 - 147
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21516116 2011 Next-generation sequencing to generate interactome datasets.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15140762 2004 AVP-induced VIT32 gene expression in collecting duct cells occurs via trans-activation of a CRE in the 5'-flanking region of the VIT32 gene.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12356727 2002 A novel vasopressin-induced transcript promotes MAP kinase activation and ENaC downregulation.
9110174 1997 Large-scale concatenation cDNA sequencing.
More...