Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.87
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
active Crohn's disease -1.342 8.0e-03
adrenocortical carcinoma -1.975 3.4e-07
adult high grade glioma -1.100 2.4e-03
Astrocytoma, Pilocytic -1.100 1.5e-06
breast carcinoma -1.300 1.5e-03
colon cancer -1.900 1.0e-02
ductal carcinoma in situ -1.200 1.2e-03
ependymoma -1.100 9.0e-03
fibroadenoma -1.600 4.3e-02
glioblastoma -1.100 6.8e-07
group 3 medulloblastoma -2.000 3.9e-06
hepatocellular carcinoma -1.200 3.1e-06
inflammatory breast cancer -1.200 1.1e-03
intraductal papillary-mucinous adenoma (... 1.600 4.7e-03
intraductal papillary-mucinous neoplasm ... 1.500 1.5e-02
invasive ductal carcinoma -1.100 4.5e-03
lung adenocarcinoma -1.060 2.7e-04
lung cancer -2.000 5.9e-04
lung carcinoma -1.300 2.9e-17
non-small cell lung cancer -1.042 2.4e-11
pituitary cancer -1.300 2.5e-07
primitive neuroectodermal tumor -1.200 1.3e-04
spina bifida -1.700 2.0e-02
urothelial carcinoma -1.200 5.7e-03

Synonym

Accession Q5T686 Q53G32 Q9H2R9 Q9HBN9 AVP-induced protein 1
Symbols VIP32
VIT32
PP5395

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (10)

Gene RIF (1)

AA Sequence

MGTPASVVSEPPPWQAPIEARGRKQASANIFQDAELLQIQALFQRSGDQLAEERAQIIWECAGDHRVAEA      1 - 70
LKRLRRKRPPRQKPLGHSLHHCSRLRILEPHSALANPQSATETASSEQYLHSRKKSARIRRNWRKSGPTS     71 - 140
YLHQIRH                                                                   141 - 147
//

Text Mined References (12)

PMID Year Title