Property Summary

NCBI Gene PubMed Count 14
Grant Count 1
Funding $192,949.22
PubMed Score 4.47
PubTator Score 5.28

Knowledge Summary

Patent (5,629)

Expression

  Differential Expression (12)

Synonym

Accession Q5T601 Q5KU15 Q5T5Z9 Q5T600 Q86SM1 Q8IXE3 Q8IZF8 Q96DQ1 Q9H615
Symbols PGR19
GPR110
KPG_012
hGPCR36

Gene

 Grant Application (1)

Gene RIF (2)

PMID Text
25918380 GPR56 and GPR110 are activated by exposure of a cryptic tethered agonist
20149256 GPR110 is an oncogene overexpressed in lung and prostate cancer

AA Sequence

MKVGVLWLISFFTFTDGHGGFLGKNDGIKTKKELIVNKKKHLGPVEEYQLLLQVTYRDSKEKRDLRNFLK      1 - 70
LLKPPLLWSHGLIRIIRAKATTDCNSLNGVLQCTCEDSYTWFPPSCLDPQNCYLHTAGALPSCECHLNNL     71 - 140
SQSVNFCERTKIWGTFKINERFTNDLLNSSSAIYSKYANGIEIQLKKAYERIQGFESVQVTQFRNGSIVA    141 - 210
GYEVVGSSSASELLSAIEHVAEKAKTALHKLFPLEDGSFRVFGKAQCNDIVFGFGSKDDEYTLPCSSGYR    211 - 280
GNITAKCESSGWQVIRETCVLSLLEELNKNFSMIVGNATEAAVSSFVQNLSVIIRQNPSTTVGNLASVVS    281 - 350
ILSNISSLSLASHFRVSNSTMEDVISIADNILNSASVTNWTVLLREEKYASSRLLETLENISTLVPPTAL    351 - 420
PLNFSRKFIDWKGIPVNKSQLKRGYSYQIKMCPQNTSIPIRGRVLIGSDQFQRSLPETIISMASLTLGNI    421 - 490
LPVSKNGNAQVNGPVISTVIQNYSINEVFLFFSKIESNLSQPHCVFWDFSHLQWNDAGCHLVNETQDIVT    491 - 560
CQCTHLTSFSILMSPFVPSTIFPVVKWITYVGLGISIGSLILCLIIEALFWKQIKKSQTSHTRRICMVNI    561 - 630
ALSLLIADVWFIVGATVDTTVNPSGVCTAAVFFTHFFYLSLFFWMLMLGILLAYRIILVFHHMAQHLMMA    631 - 700
VGFCLGYGCPLIISVITIAVTQPSNTYKRKDVCWLNWSNGSKPLLAFVVPALAIVAVNFVVVLLVLTKLW    701 - 770
RPTVGERLSRDDKATIIRVGKSLLILTPLLGLTWGFGIGTIVDSQNLAWHVIFALLNAFQGFFILCFGIL    771 - 840
LDSKLRQLLFNKLSALSSWKQTEKQNSSDLSAKPKFSKPFNPLQNKGHYAFSHTGDSSDNIMLTQFVSNE    841 - 910
//

Text Mined References (15)

PMID Year Title
25918380 2015 Adhesion G protein-coupled receptors are activated by exposure of a cryptic tethered agonist.
25713288 2015 International Union of Basic and Clinical Pharmacology. XCIV. Adhesion G protein-coupled receptors.
20149256 2010 Orphan receptor GPR110, an oncogene overexpressed in lung and prostate cancer.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15203201 2004 The human and mouse repertoire of the adhesion family of G-protein-coupled receptors.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14623098 2003 Seven evolutionarily conserved human rhodopsin G protein-coupled receptors lacking close relatives.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12679517 2003 The G protein-coupled receptor repertoires of human and mouse.
More...