Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.16
PubTator Score 3.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
esophageal adenocarcinoma -1.400 0.018
psoriasis -1.700 0.002
osteosarcoma -1.168 0.002
ependymoma -1.300 0.000
glioblastoma -1.300 0.000
intraductal papillary-mucinous adenoma (... 1.700 0.001
intraductal papillary-mucinous carcinoma... 2.000 0.000
intraductal papillary-mucinous neoplasm ... 2.200 0.003
lung cancer 1.500 0.001
colon cancer 1.300 0.049
Breast cancer 2.600 0.027
adult high grade glioma -1.300 0.000
group 4 medulloblastoma 1.300 0.000
pilocytic astrocytoma -1.400 0.000
subependymal giant cell astrocytoma -1.954 0.003
spina bifida -1.236 0.037
ovarian cancer 1.600 0.000

Gene RIF (3)

PMID Text
24706919 These results show that members of the CAMSAP/Patronin family all localize to and protect minus-ends but have evolved distinct effects on microtubule dynamics.
24603804 Results show that Camsap1 is related with the prognosis of laryngeal squamous cell carcinoma patients. Its expression inducs microtubule formation and aggregation.
19508979 The CKK domain binds microtubules and represents a domain that evolved with the metazoa.

AA Sequence

MVDASGRAAAEGWRKMEAPPDGAADLVPLDRYDAARAKIAANLQWICAKAYGRDNIPEDLRDPFYVDQYE      1 - 70
QEHIKPPVIKLLLSSELYCRVCSLILKGDQVAALQGHQSVIQALSRKGIYVMESDDTPVTESDLSRAPIK     71 - 140
MSAHMAMVDALMMAYTVEMISIEKVVASVKRFSTFSASKELPYDLEDAMVFWINKVNLKMREITEKEVKL    141 - 210
KQQLLESPAHQKVRYRREHLSARQSPYFPLLEDLMRDGSDGAALLAVIHYYCPEQMKLDDICLKEVTSMA    211 - 280
DSLYNIRLLREFSNEYLNKCFYLTLEDMLYAPLVLKPNVMVFIAELFWWFENVKPDFVQPRDVQELKDAK    281 - 350
TVLHQKSSRPPVPISNATKRSFLGSPAAGTLAELQPPVQLPAEGCHRHYLHPEEPEYLGKGTAAFSPSHP    351 - 420
LLPLRQKQQKSIQGEDIPDQRHRSNSLTRVDGQPRGAAIAWPEKKTRPASQPTPFALHHAASCEVDPSSG    421 - 490
DSISLARSISKDSLASNIVNLTPQNQPHPTATKSHGKSLLSNVSIEDEEEELVAIVRADVVPQQADPEFP    491 - 560
RASPRALGLTANARSPQGQLDTSESKPDSFFLEPLMPAVLKPAKEKQVITKEDERGEGRPRSIVSRRPSE    561 - 630
GPQPLVRRKMTGSRDLNRTFTPIPCSEFPMGIDPTETGPLSVETAGEVCGGPLALGGFDPFPQGPSTDGF    631 - 700
FLHVGRADEDTEGRLYVSCSKSPNSHDSEPWTLLRQDSDSDVVDIEEAEHDFMGEAHPVVFSRYIGEEES    701 - 770
AKLQEDMKVKEHEDKDDASGRSSPCLSTASQMSSVSMASGSVKMTSFAERKLQRLNSCETKSSTSSSQKT    771 - 840
TPDASESCPAPLTTWRQKREQSPSQHGKDPASLLASELVQLHMQLEEKRRAIEAQKKKMEALSARQRLKL    841 - 910
GKAAFLHVVKKGKAEAAPPLRPEHFAKEYSQHNGEDCGDAVSKTEDFLVKEEQREELLHEPQDVDKESLA    911 - 980
FAQQHKAKDPVALHELERNKVISAALLEDTVGEVVDVNECDLSIEKLNETISTLQQAILKISQQQEQLLM    981 - 1050
KSPTVPVPGSKNNSQDHKVKAPVHFVEPLSPTGVAGHRKAPRLGQGRNSRSGRPAELKVPKDRPQGSSRS   1051 - 1120
KTPTPSVETLPHLRPFPASSHPRTPTDPGLDSALEPSGDPHGKCLFDSYRLHDESNQRTLTLSSSKDANI   1121 - 1190
LSEQMSLKEVLDASVKEVGSSSSDVSGKESVPVEEPLRSRASLIEVDLSDLKAPDEDGELVSLDGSADLV   1191 - 1260
SEGDQKPGVGFFFKDEQKAEDELAKKRAAFLLKQQRKAEEARVRKQQLEAEVELKRDEARRKAEEDRVRK   1261 - 1330
EEEKARRELIKQEYLRRKQQQILEEQGLGKPKSKPKKPRPKSVHREESCSDSGTKCSSTPDNLSRTQSGS   1331 - 1400
SLSLASAATTEPESVHSGGTPSQRVESMEALPILSRNPSRSTDRDWETASAASSLASVAEYTGPKLFKEP   1401 - 1470
SSKSNKPIIHNAISHCCLAGKVNEPHKNSILEELEKCDANHYIILFRDAGCQFRALYCYYPDTEEIYKLT   1471 - 1540
GTGPKNITKKMIDKLYKYSSDRKQFNLIPAKTMSVSVDALTIHNHLWQPKRPAVPKKAQTRK           1541 - 1602
//

Text Mined References (17)

PMID Year Title
24706919 2014 Regulation of microtubule minus-end dynamics by CAMSAPs and Patronin.
24603804 2014 MicroRNA-126 modulates the tumor microenvironment by targeting calmodulin-regulated spectrin-associated protein 1 (Camsap1).
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24117850 2014 A conserved sequence in calmodulin regulated spectrin-associated protein 1 links its interaction with spectrin and calmodulin to neurite outgrowth.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21834987 2011 Identification and characterization of a set of conserved and new regulators of cytoskeletal organization, cell morphology and migration.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19508979 2009 The CKK domain (DUF1781) binds microtubules and defines the CAMSAP/ssp4 family of animal proteins.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...