Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.38
PubTator Score 3.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.300 8.4e-05
Astrocytoma, Pilocytic -1.400 2.4e-08
Breast cancer 2.600 2.7e-02
colon cancer 1.300 4.9e-02
ependymoma -1.300 2.0e-10
esophageal adenocarcinoma -1.400 1.8e-02
glioblastoma -1.300 9.3e-05
group 4 medulloblastoma 1.300 8.7e-05
intraductal papillary-mucinous adenoma (... 1.700 6.3e-04
intraductal papillary-mucinous carcinoma... 1.200 5.4e-03
intraductal papillary-mucinous neoplasm ... 2.200 3.0e-03
lung cancer 1.200 4.5e-02
osteosarcoma -1.168 2.2e-03
ovarian cancer 1.600 1.6e-04
psoriasis 1.500 6.4e-04
spina bifida -1.179 3.2e-02
subependymal giant cell astrocytoma -1.954 3.4e-03

Gene RIF (4)

AA Sequence

MVDASGRAAAEGWRKMEAPPDGAADLVPLDRYDAARAKIAANLQWICAKAYGRDNIPEDLRDPFYVDQYE      1 - 70
QEHIKPPVIKLLLSSELYCRVCSLILKGDQVAALQGHQSVIQALSRKGIYVMESDDTPVTESDLSRAPIK     71 - 140
MSAHMAMVDALMMAYTVEMISIEKVVASVKRFSTFSASKELPYDLEDAMVFWINKVNLKMREITEKEVKL    141 - 210
KQQLLESPAHQKVRYRREHLSARQSPYFPLLEDLMRDGSDGAALLAVIHYYCPEQMKLDDICLKEVTSMA    211 - 280
DSLYNIRLLREFSNEYLNKCFYLTLEDMLYAPLVLKPNVMVFIAELFWWFENVKPDFVQPRDVQELKDAK    281 - 350
TVLHQKSSRPPVPISNATKRSFLGSPAAGTLAELQPPVQLPAEGCHRHYLHPEEPEYLGKGTAAFSPSHP    351 - 420
LLPLRQKQQKSIQGEDIPDQRHRSNSLTRVDGQPRGAAIAWPEKKTRPASQPTPFALHHAASCEVDPSSG    421 - 490
DSISLARSISKDSLASNIVNLTPQNQPHPTATKSHGKSLLSNVSIEDEEEELVAIVRADVVPQQADPEFP    491 - 560
RASPRALGLTANARSPQGQLDTSESKPDSFFLEPLMPAVLKPAKEKQVITKEDERGEGRPRSIVSRRPSE    561 - 630
GPQPLVRRKMTGSRDLNRTFTPIPCSEFPMGIDPTETGPLSVETAGEVCGGPLALGGFDPFPQGPSTDGF    631 - 700
FLHVGRADEDTEGRLYVSCSKSPNSHDSEPWTLLRQDSDSDVVDIEEAEHDFMGEAHPVVFSRYIGEEES    701 - 770
AKLQEDMKVKEHEDKDDASGRSSPCLSTASQMSSVSMASGSVKMTSFAERKLQRLNSCETKSSTSSSQKT    771 - 840
TPDASESCPAPLTTWRQKREQSPSQHGKDPASLLASELVQLHMQLEEKRRAIEAQKKKMEALSARQRLKL    841 - 910
GKAAFLHVVKKGKAEAAPPLRPEHFAKEYSQHNGEDCGDAVSKTEDFLVKEEQREELLHEPQDVDKESLA    911 - 980
FAQQHKAKDPVALHELERNKVISAALLEDTVGEVVDVNECDLSIEKLNETISTLQQAILKISQQQEQLLM    981 - 1050
KSPTVPVPGSKNNSQDHKVKAPVHFVEPLSPTGVAGHRKAPRLGQGRNSRSGRPAELKVPKDRPQGSSRS   1051 - 1120
KTPTPSVETLPHLRPFPASSHPRTPTDPGLDSALEPSGDPHGKCLFDSYRLHDESNQRTLTLSSSKDANI   1121 - 1190
LSEQMSLKEVLDASVKEVGSSSSDVSGKESVPVEEPLRSRASLIEVDLSDLKAPDEDGELVSLDGSADLV   1191 - 1260
SEGDQKPGVGFFFKDEQKAEDELAKKRAAFLLKQQRKAEEARVRKQQLEAEVELKRDEARRKAEEDRVRK   1261 - 1330
EEEKARRELIKQEYLRRKQQQILEEQGLGKPKSKPKKPRPKSVHREESCSDSGTKCSSTPDNLSRTQSGS   1331 - 1400
SLSLASAATTEPESVHSGGTPSQRVESMEALPILSRNPSRSTDRDWETASAASSLASVAEYTGPKLFKEP   1401 - 1470
SSKSNKPIIHNAISHCCLAGKVNEPHKNSILEELEKCDANHYIILFRDAGCQFRALYCYYPDTEEIYKLT   1471 - 1540
GTGPKNITKKMIDKLYKYSSDRKQFNLIPAKTMSVSVDALTIHNHLWQPKRPAVPKKAQTRK           1541 - 1602
//

Text Mined References (19)

PMID Year Title