Property Summary

NCBI Gene PubMed Count 16
PubMed Score 8.27
PubTator Score 8.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Synonym

Accession Q5T5U3 Q0VF98 Q7Z3P7 Q8N3A2 Q8NI19 Q8TBV5 Q9P2C3
Symbols ARHGAP10

Gene

PDB

2DHJ   2J59   2YUY  

 GO Function (1)

Gene RIF (10)

PMID Text
25691070 Gly1121Ser variant in ARHGAP21 gene found to be shared by all MP individuals in arger branch of family with nearly complete penetrance. ARHGAP21 protein strengthens cell-cell adhesions; may be regulated by BMPs influencing mandibular growth.
23235160 ARHGAP21 is a Rho-GAP involved in cell-cell junction remodeling that affects migration and EMT through alpha-tubulin interaction and acetylation
22922005 Co-immunoprecipitations and in vitro SUMOylation confirmed ARHGAP21 specific modification by SUMO2/3 and mapped the SUMOylation site to ARHGAP21 lysine K1443.
22318733 silencing Cdc42 reduced influenza A virus replication, whereas silencing ARHGAP21 increased the virus replication.
21173159 Disruption of the beta-arrestin 1/ARHGAP21 complex results in a more active ARHGAP21, leading to less efficient signaling via the angiotensin II type 1A receptor and, thereby, attenuation of stimulated stress fiber formation.
19268501 Data demonstrate that the RhoGTPase activating protein 21 (ARHGAP21) is expressed in the nuclear and perinuclear regions of several cell lines, and interacts with the C-terminal region of focal adhesion kinase.
17347647 The crystal structure of the activated GTP-bound form of ARF1 in a complex with the Arf-binding domain (ArfBD) of ARHGAP21 at 2.1 A resolution, is presented.
16385451 Observational study of gene-disease association. (HuGE Navigator)
15793564 The ARHGAP10 protein is a novel Rho GTPase-activating protein (Rho-GAP) that is recruited to Golgi membranes through binding to GTP-ARF1.
12056806 ARHGAP10 gene is highly expressed in muscle and brain, which are highly differentiated tissues. It supports the hypothesis that ARHGAP10 is important for cell differentiation

AA Sequence

MATRRTGLSEGDGDKLKACEVSKNKDGKEQSETVSLSEDETFSWPGPKTVTLKRTSQGFGFTLRHFIVYP      1 - 70
PESAIQFSYKDEENGNRGGKQRNRLEPMDTIFVKQVKEGGPAFEAGLCTGDRIIKVNGESVIGKTYSQVI     71 - 140
ALIQNSDTTLELSVMPKDEDILQVLQFTKDVTALAYSQDAYLKGNEAYSGNARNIPEPPPICYPWLPSAP    141 - 210
SAMAQPVEISPPDSSLSKQQTSTPVLTQPGRAYRMEIQVPPSPTDVAKSNTAVCVCNESVRTVIVPSEKV    211 - 280
VDLLSNRNNHTGPSHRTEEVRYGVSEQTSLKTVSRTTSPPLSIPTTHLIHQPAGSRSLEPSGILLKSGNY    281 - 350
SGHSDGISSSRSQAVEAPSVSVNHYSPNSHQHIDWKNYKTYKEYIDNRRLHIGCRTIQERLDSLRAASQS    351 - 420
TTDYNQVVPNRTTLQGRRRSTSHDRVPQSVQIRQRSVSQERLEDSVLMKYCPRSASQGALTSPSVSFSNH    421 - 490
RTRSWDYIEGQDETLENVNSGTPIPDSNGEKKQTYKWSGFTEQDDRRGICERPRQQEIHKSFRGSNFTVA    491 - 560
PSVVNSDNRRMSGRGVGSVSQFKKIPPDLKTLQSNRNFQTTCGMSLPRGISQDRSPLVKVRSNSLKAPST    561 - 630
HVTKPSFSQKSFVSIKDQRPVNHLHQNSLLNQQTWVRTDSAPDQQVETGKSPSLSGASAKPAPQSSENAG    631 - 700
TSDLELPVSQRNQDLSLQEAETEQSDTLDNKEAVILREKPPSGRQTPQPLRHQSYILAVNDQETGSDTTC    701 - 770
WLPNDARREVHIKRMEERKASSTSPPGDSLASIPFIDEPTSPSIDHDIAHIPASAVISASTSQVPSIATV    771 - 840
PPCLTTSAPLIRRQLSHDHESVGPPSLDAQPNSKTERSKSYDEGLDDYREDAKLSFKHVSSLKGIKIADS    841 - 910
QKSSEDSGSRKDSSSEVFSDAAKEGWLHFRPLVTDKGKRVGGSIRPWKQMYVVLRGHSLYLYKDKREQTT    911 - 980
PSEEEQPISVNACLIDISYSETKRKNVFRLTTSDCECLFQAEDRDDMLAWIKTIQESSNLNEEDTGVTNR    981 - 1050
DLISRRIKEYNNLMSKAEQLPKTPRQSLSIRQTLLGAKSEPKTQSPHSPKEESERKLLSKDDTSPPKDKG   1051 - 1120
TWRKGIPSIMRKTFEKKPTATGTFGVRLDDCPPAHTNRYIPLIVDICCKLVEERGLEYTGIYRVPGNNAA   1121 - 1190
ISSMQEELNKGMADIDIQDDKWRDLNVISSLLKSFFRKLPEPLFTNDKYADFIEANRKEDPLDRLKTLKR   1191 - 1260
LIHDLPEHHYETLKFLSAHLKTVAENSEKNKMEPRNLAIVFGPTLVRTSEDNMTHMVTHMPDQYKIVETL   1261 - 1330
IQHHDWFFTEEGAEEPLTTVQEESTVDSQPVPNIDHLLTNIGRTGVSPGDVSDSATSDSTKSKGSWGSGK   1331 - 1400
DQYSRELLVSSIFAAASRKRKKPKEKAQPSSSEDELDNVFFKKENVEQCHNDTKEESKKESETLGRKQKI   1401 - 1470
IIAKENSTRKDPSTTKDEKISLGKESTPSEEPSPPHNSKHNKSPTLSCRFAILKESPRSLLAQKSSHLEE   1471 - 1540
TGSDSGTLLSTSSQASLARFSMKKSTSPETKHSEFLANVSTITSDYSTTSSATYLTSLDSSRLSPEVQSV   1541 - 1610
AESKGDEADDERSELISEGRPVETDSESEFPVFPTALTSERLFRGKLQEVTKSSRRNSEGSELSCTEGSL   1611 - 1680
TSSLDSRRQLFSSHKLIECDTLSRKKSARFKSDSGSLGDAKNEKEAPSLTKVFDVMKKGKSTGSLLTPTR   1681 - 1750
GESEKQEPTWKTKIADRLKLRPRAPADDMFGVGNHKVNAETAKRKSIRRRHTLGGHRDATEISVLNFWKV   1751 - 1820
HEQSGERESELSAVNRLKPKCSAQDLSISDWLARERLRTSTSDLSRGEIGDPQTENPSTREIATTDTPLS   1821 - 1890
LHCNTGSSSSTLASTNRPLLSIPPQSPDQINGESFQNVSKNASSAANAQPHKLSETPGSKAEFHPCL      1891 - 1957
//

Text Mined References (33)

PMID Year Title
25691070 2015 Genetic association of ARHGAP21 gene variant with mandibular prognathism.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23235160 2013 ARHGAP21 protein, a new partner of ?-tubulin involved in cell-cell adhesion formation and essential for epithelial-mesenchymal transition.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22922005 2012 Post-translational modification of the RhoGTPase activating protein 21, ARHGAP21, by SUMO2/3.
22318733 2012 Transport of influenza virus neuraminidase (NA) to host cell surface is regulated by ARHGAP21 and Cdc42 proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21173159 2011 ?-Arrestin 1 inhibits the GTPase-activating protein function of ARHGAP21, promoting activation of RhoA following angiotensin II type 1A receptor stimulation.
20525016 2010 Cdc42 regulates microtubule-dependent Golgi positioning.
More...